Recombinant Bacillus subtilis Motility protein A (motA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
motA; BSU13690; Motility protein A; Chemotaxis protein MotA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
motA
Target Protein Sequence
MDKTSLIGIILAFVALSVGMVLKGVSFSALANPAAILIIIAGTISAVVIAFPTKEIKKVP TLFRVLFKENKQLTIEELIPMFSEWAQLARREGLLALEASIEDVDDAFLKNGLSMAVDGQ SAEFIRDIMTEEVEAMEDRHQAGAAIFTQAGTYAPTLGVLGAVIGLIAALSHMDNTDELG HAISAAFVATLLGIFTGYVLWHPFANKLKRKSKQEVKLREVMIEGVLSVLEGQAPKVIEQ KLLMYLPAKDRLKFAEQGEAQNGEKKEEEA
Uniprot No.

Target Background

Function
MotA and MotB constitute the stator element of the flagellar motor complex. They are essential for the rotation of the flagellar motor and likely function as transmembrane proton channels.
Gene References Into Functions
  1. To elucidate the roles of conserved charged residues in the cytoplasmic loops of MotA and MotP in flagellar rotation, site-directed mutagenesis was performed. The study analyzed motility and the relative expression levels of mutant Mot proteins. PMID: 24771657
Database Links
Protein Families
MotA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is motA and what is its role in Bacillus subtilis motility?

MotA is a flagellar motor protein that forms part of the stator complex in B. subtilis. It functions as a force generator that energizes the rotation of bacterial flagella. B. subtilis possesses two distinct stator-force generators: the H+-coupled MotAB complex and the Na+-coupled MotPS complex . MotA specifically functions within the MotAB complex, which uses proton (H+) motive force to drive flagellar rotation. This protein is essential for proper swimming and swarming motility in B. subtilis.

Research has shown that the stator complex contains four MotA proteins and two MotB proteins, forming a structure with eighteen transmembrane segments (TMS) and two ion channel pathways . MotA works by converting electrochemical energy into mechanical torque that powers flagellar rotation.

How does the structure of motA relate to its function?

MotA features multiple transmembrane domains that anchor it within the cell membrane. These domains are critical for forming the ion channel that enables proton flow, which powers flagellar rotation. The cytoplasmic domains of MotA interact with components of the flagellar rotor, particularly FliG, to convert ion flow into rotational force.

Structural studies indicate that MotA assembles with MotB to form a functional stator unit. Each stator complex contains four MotA proteins and two MotB proteins . This structural arrangement creates the necessary channels for proton translocation and the interfaces required for force generation and transmission to the flagellar motor.

What are the most effective methods for creating recombinant B. subtilis motA protein?

For recombinant motA production, researchers typically employ molecular cloning strategies using expression vectors compatible with either E. coli or B. subtilis systems. The coding sequence of motA can be amplified by PCR using B. subtilis chromosomal DNA as the template with specific primers that include appropriate restriction sites. As demonstrated in the literature, researchers have successfully used primers B2motA-F and B2motA-R to amplify the motA gene (excluding the stop codon) for cloning purposes .

For protein-protein interaction studies, motA has been successfully cloned into vectors like pKNT25, generating recombinant plasmids that enable functional analysis . Expression can be performed under the control of inducible promoters, such as the IPTG-inducible Pspac promoter, which allows for controlled expression levels .

When purifying recombinant MotA, it's critical to optimize detergent conditions given its membrane-associated nature. Typically, a combination of affinity chromatography (using His-tag or other fusion tags) followed by size exclusion chromatography yields the best results for obtaining pure, functional protein.

What experimental approaches can assess the functional activity of recombinant motA?

Several methods can be employed to evaluate motA functionality:

  • Motility assays: Swimming assays in liquid media and swarming assays on soft agar plates are standard methods to assess motA function. Research shows that strains with functional MotA/MotB exhibit measurable motility on soft agar plates and in liquid media . Specifically, variations in carbon source (glucose vs. malate), pH, and sodium concentration can be used to differentiate the activity of MotA-containing complexes from other stator complexes.

  • Complementation studies: Introducing recombinant motA into motA-deficient strains (ΔmotA) to restore motility provides direct evidence of protein functionality. Research has shown that expression of motA under control of its native promoter or an inducible promoter can restore motility in motA deletion strains .

  • Protein-protein interaction assays: Techniques such as bacterial two-hybrid systems have been used to study interactions between MotA and other flagellar components, including YpfA . These systems help identify residues critical for function and interaction.

  • Flagellar rotation measurements: Direct measurement of flagellar rotation speed and torque using techniques such as tethered cell assays can quantitatively assess MotA functionality.

How do mutations in motA affect bacterial motility and other phenotypes?

Mutations in motA have significant consequences for bacterial behavior:

  • Motility defects: Loss of motA function results in non-motile or severely impaired motility phenotypes. Research demonstrates that B. subtilis strains lacking functional motA are defective in both swimming and swarming motility .

  • PGA overproduction: Interestingly, research has revealed that mutants with abolished stator function, including motA defects, result in overproduction of the extracellular polymer poly-γ-glutamate (PGA), conferring a mucoid colony phenotype . This unexpected connection between motility defects and PGA production suggests a regulatory link between these two processes.

  • Flagellar assembly effects: The number and length of flagella can be affected by motA mutations. As shown in the table below from experimental research, strains with functional MotA typically have more and longer flagella compared to motility-deficient strains:

Strain TypeNumber of flagella/cell (Range)Number of flagella/cell (Average)Length of flagella (Range in μm)Length of flagella (Average in μm)
wild type9-1612.36.1-9.37.5
MotAB9-1510.85.0-8.97.0
ΔABΔPSa1-63.61.8-5.74.0

Data from experimental research with B. subtilis strains
a ΔABΔPS refers to a strain where both motAB and motPS genes were deleted.

How does the MotA/MotB complex differ functionally from the MotP/MotS complex in B. subtilis?

The B. subtilis genome contains two distinct sets of stator proteins: MotA/MotB and MotP/MotS, which differ in their coupling ions and functional properties:

  • Ion coupling: MotA/MotB uses the H+ gradient, while MotP/MotS uses the Na+ gradient to power flagellar rotation .

  • Environmental adaptations: The two systems show different environmental preferences:

    • MotA/MotB performs better on glucose than malate as a carbon source

    • MotA/MotB shows no positive effect from elevated Na+ concentration or pH

    • MotP/MotS exhibits better motility on malate than glucose

    • MotP/MotS performs better at elevated Na+ concentrations and somewhat better at elevated pH

  • Swarming motility: Research has shown that B. subtilis requires only the MotA/MotB stator during swarming motility, indicating specialized roles for each stator system .

  • Conservation: The residues required for stator force generation are highly conserved from Proteobacteria to Firmicutes, suggesting fundamental mechanistic similarities despite the differences in ion coupling .

How does cyclic di-GMP signaling influence motA function in B. subtilis?

Research has uncovered a significant relationship between cyclic di-GMP (c-di-GMP) signaling and motA function:

  • YpfA-motA interaction: Evidence indicates that YpfA, a putative c-di-GMP receptor, inhibits motility by interacting directly with the flagellar motor protein MotA . Mass spectrometry analysis showed that MotA was among several dozen abundant proteins that copurified with GST-YpfA, suggesting a physical interaction between these proteins.

  • Regulatory pathway: YpfA inhibits motility in response to rising levels of c-di-GMP during entry into stationary phase. This occurs due to the downregulation of yuxH (a c-di-GMP-degrading phosphodiesterase) by Spo0A~P, the master regulator of stationary phase and sporulation .

  • Motility-biofilm transition: This interaction represents a mechanism for the transition from motile to sessile lifestyles in B. subtilis, as c-di-GMP signaling is known to promote biofilm formation while inhibiting motility in many bacterial species.

What role does motA play in maintaining a motile subpopulation within B. subtilis biofilms?

Recent research has revealed fascinating insights into the role of motility within seemingly static biofilms:

  • Motile reserves: B. subtilis maintains a motile subpopulation of cells within biofilms that is required for the biofilms to spread over foreign objects . This indicates that biofilms, while largely composed of sessile cells, actively maintain a degree of motility.

  • TasA signaling: The extracellular matrix (ECM) protein TasA plays a dual role in this process. Beyond its structural function as an adhesive fiber, TasA acts as a developmental signal that stimulates a subset of biofilm cells to revert from a matrix-producing state to a motile state . This reversion involves the expression of flagellar genes, including those encoding motA.

  • Regulatory antagonism: Activation of the biofilm-motility switch by the two-component system CssR/CssS antagonizes the TasA-mediated reversion to motility in biofilm cells . This creates a balanced regulation that maintains appropriate proportions of motile and sessile cells within biofilms.

What techniques can be used to study motA localization and dynamics in live cells?

Advanced microscopy techniques have revolutionized our understanding of flagellar motor assembly and function:

  • Fluorescent protein fusions: Creating functional fusions of motA with fluorescent proteins (such as GFP or mCherry) allows visualization of its localization and dynamics. Care must be taken to ensure the fusion does not interfere with motA function, typically by using flexible linkers between the protein and the fluorescent tag.

  • Total Internal Reflection Fluorescence (TIRF) microscopy: This technique is particularly useful for studying membrane-associated proteins like motA, as it selectively illuminates molecules near the cell surface with minimal background from cytoplasmic fluorescence.

  • Single-molecule tracking: Advanced tracking algorithms applied to high-speed microscopy data can reveal the dynamics of individual motA molecules, including diffusion rates, clustering behavior, and exchange with the cytoplasmic pool.

  • Fluorescence Recovery After Photobleaching (FRAP): This technique can measure the turnover rate of motA within the stator complex by bleaching fluorescently labeled motA at the flagellar motor and measuring the recovery of fluorescence over time.

  • Super-resolution microscopy: Techniques such as STORM, PALM, or STED microscopy can resolve the arrangement of individual stator units around the flagellar motor, providing insights into stoichiometry and assembly dynamics that are not visible with conventional microscopy.

How can researchers overcome expression and solubility issues with recombinant motA?

As a membrane protein, motA presents several challenges for recombinant expression and purification:

  • Expression systems: Using B. subtilis as an expression host rather than E. coli can improve proper folding and membrane insertion. Alternatively, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) may improve yields.

  • Fusion partners: N-terminal fusions with highly soluble partners like MBP (maltose-binding protein) or SUMO can improve expression levels and potentially solubility.

  • Detergent screening: Systematic screening of detergents is essential for extracting and maintaining motA in a functional state. Mild detergents like DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) often work well for membrane proteins.

  • Expression conditions: Lowering the expression temperature (16-20°C) and using lower inducer concentrations can promote proper folding by slowing the production rate.

  • Nanodiscs or amphipols: These membrane-mimetic systems can improve stability of purified motA by providing a more native-like environment than detergent micelles alone.

What controls should be included when assessing motA-dependent phenotypes?

Proper experimental design requires appropriate controls to accurately interpret motA-related phenotypes:

  • Wild-type strain: Include the parental strain as a positive control for normal motility and other phenotypes.

  • Complete deletion mutant: A strain with both motAB and motPS operons deleted (ΔABΔPS) serves as a negative control for flagellar motility .

  • Single gene complementation: Express motA alone in a motA deletion background to confirm that observed effects are specifically due to motA and not polar effects on downstream genes.

  • Point mutants: Include strains with specific amino acid substitutions in conserved motA residues to distinguish between structural and functional roles of different protein domains.

  • Alternative stator control: Compare phenotypes with a strain expressing only MotPS to differentiate between general motility effects and those specific to the MotA/MotB stator system .

How might motA function be harnessed for synthetic biology applications?

The unique properties of motA and bacterial flagellar motors present several opportunities for synthetic biology:

  • Bio-nanomotors: The highly efficient energy conversion of the flagellar motor (nearly 100% under certain conditions) makes it an attractive model for designing synthetic molecular motors.

  • Biosensing applications: Engineering motA-based systems that respond to specific environmental signals could create sensitive biosensors that transduce chemical signals into mechanical motion.

  • Controlled cellular movement: Engineered motA variants with altered ion specificity or regulatory properties could enable precise control of bacterial movement in response to specific signals, with applications in targeted delivery or environmental remediation.

  • Protein export systems: The flagellar assembly machinery is related to type III secretion systems. Understanding motA's role in this process could inform the design of efficient protein export systems for biotechnology applications.

What is the evolutionary relationship between different bacterial stator systems?

Understanding the evolutionary history of bacterial stator systems raises several interesting research questions:

  • Evolutionary origins: Did the dual stator systems in B. subtilis (MotA/MotB and MotP/MotS) arise from gene duplication followed by specialization, or through horizontal gene transfer?

  • Selective pressures: What environmental or ecological factors drove the evolution of H+-coupled versus Na+-coupled stator systems? Research indicates that the residues required for stator force generation are highly conserved from Proteobacteria to Firmicutes , suggesting fundamental functional constraints despite evolutionary divergence.

  • Comparative genomics: How do the stator systems vary across different Bacillus species and other Firmicutes? Are there correlations between stator system composition and ecological niche?

  • Ancestral reconstruction: Can we infer the properties of ancestral stator proteins and understand the evolutionary trajectory that led to the current diversity of systems?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.