Recombinant Bacillus subtilis Multidrug resistance ABC transporter ATP-binding/permease protein BmrA (bmrA)

Shipped with Ice Packs
In Stock

Description

Mechanism of Action

BmrA operates as a homodimeric ATP-binding cassette (ABC) transporter, alternating between inward-facing (IF) and outward-facing (OF) states to expel substrates. Key mechanistic insights include:

  • ATP-Driven Conformational Changes:

    • ATP binding (without hydrolysis) induces the OF state, enabling substrate release .

    • Mutant studies (e.g., catalytic mutant E504A) confirm ATP hydrolysis is not required for OF transition .

  • Role of the X-Loop:

    • The conserved X-loop residue E474 is critical for coupling ATP hydrolysis to transport. Mutations (e.g., E474R) uncouple ATPase activity from drug efflux while retaining ATP hydrolysis at ~70% of wild-type activity .

  • Substrate Transport:

    • Transports diverse substrates (e.g., doxorubicin, Hoechst 33342) with dissociation constants (K<sub>D</sub>) of 10–17 μM .

    • Larger substrates like 7-aminoactinomycin D require wider NBD separation for efficient transport .

Conformational States

  • Inward-Facing (IF) State:

    • NBDs (nucleotide-binding domains) are separated, allowing substrate entry from the lipid bilayer .

  • Outward-Facing (OF) State:

    • ATP binding triggers NBD dimerization, stiffening transmembrane helices to expel substrates .

Research Applications

  • Drug Resistance Studies:

    • Serves as a model for understanding multidrug efflux in pathogens .

  • Biophysical Techniques:

    • Solid-state NMR and cryo-EM reveal residue-specific dynamics during transport .

    • EPR spectroscopy measures distances between NBDs in different states .

Reconstitution and Stability

  • Lipid Reconstitution:

    • Optimal stability achieved in B. subtilis lipids at lipid-protein ratio (LPR) 0.5 w/w, yielding narrow NMR resonance lines (0.5 ppm linewidth) .

  • Sample Longevity:

    • Stable for months at -80°C; repeated freeze-thaw cycles degrade activity .

Implications for Antibiotic Development

  • Therapeutic Targeting:

    • Disrupting NBD-TMD coupling (e.g., via X-loop inhibitors) could block efflux without affecting ATPase function .

  • Substrate Specificity:

    • Structural flexibility allows transport of diverse molecules, complicating drug design .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Specify your desired tag type for preferential development.
Synonyms
bmrA; yvcC; BSU34820; Multidrug resistance ABC transporter ATP-binding/permease protein BmrA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
bmrA
Target Protein Sequence
MPTKKQKSKSKLKPFFALVRRTNPSYGKLAFALALSVVTTLVSLLIPLLTKQLVDGFSMS NLSGTQIGLIALVFFVQAGLSAYATYALNYNGQKIISGLRELLWKKLIKLPVSYFDTNAS GETVSRVTNDTMVVKELITTHISGFITGIISVIGSLTILFIMNWKLTLLVLVVVPLAALI LVPIGRKMFSISRETQDETARFTGLLNQILPEIRLVKASNAEDVEYGRGKMGISSLFKLG VREAKVQSLVGPLISLVLMAALVAVIGYGGMQVSSGELTAGALVAFILYLFQIIMPMGQI TTFFTQLQKSIGATERMIEILAEEEEDTVTGKQIENAHLPIQLDRVSFGYKPDQLILKEV SAVIEAGKVTAIVGPSGGGKTTLFKLLERFYSPTAGTIRLGDEPVDTYSLESWREHIGYV SQESPLMSGTIRENICYGLERDVTDAEIEKAAEMAYALNFIKELPNQFDTEVGERGIMLS GGQRQRIAIARALLRNPSILMLDEATSSLDSQSEKSVQQALEVLMEGRTTIVIAHRLSTV VDADQLLFVEKGEITGRGTHHELMASHGLYRDFAEQQLKMNADLENKAG
Uniprot No.

Target Background

Function
BmrA is an efflux transporter capable of transporting Hoechst 33342, ethidium bromide, doxorubicin, and various other drugs in vitro into inside-out vesicles. Its endogenous substrate remains unidentified. ATP-binding-induced NBD dimerization likely triggers a significant conformational change responsible for substrate translocation. Transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) provides energy (Probable).
Gene References Into Functions
  1. Data supports a drug transport mechanism involving substantial conformational changes in BmrA, demonstrating that a bacterial ABC exporter can adopt at least two open inward conformations within the lipid membrane. PMID: 24630999
Database Links
Protein Families
ABC transporter superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is BmrA and what is its fundamental structure and function?

BmrA (Bacillus multidrug resistance ATP) is a homodimeric ATP-binding cassette (ABC) transporter from Bacillus subtilis that functions as a molecular pump to translocate various molecules across the cell membrane. It belongs to the ABC exporter family involved in multidrug resistance phenotypes that can contribute to antimicrobial resistance in bacteria . BmrA has a molecular weight of approximately 64.5 kDa per monomer . Structurally, it consists of nucleotide-binding domains (NBDs) that bind and hydrolyze ATP, and transmembrane domains (TMDs) that form the substrate translocation pathway. The protein functions via an alternating access mechanism where the NBDs undergo conformational changes during the ATP catalytic cycle (binding, hydrolysis, and ADP/Pi release) that are transmitted to the TMDs, switching the transporter between inward-facing (IF) and outward-facing (OF) conformations .

What expression systems and purification methods are most effective for obtaining functional recombinant BmrA?

Recombinant BmrA is typically expressed in Escherichia coli BL21C43 strain using a construct containing a His-tag (usually N-terminal) for purification purposes . The protein can be efficiently purified using Immobilized Metal Affinity Chromatography (IMAC) . For functional studies, the purified protein is typically maintained in a buffer containing 50 mM Tris-Cl pH 8.0, 100 mM NaCl, 0.01% DDM (n-Dodecyl β-D-maltoside), and 10% glycerol to preserve its stability and activity .

The functional integrity of the purified protein can be verified through ATPase activity assays . For structural and mechanistic studies, the protein is often reconstituted into lipids or nanodiscs to better mimic its native membrane environment, particularly when using techniques like solid-state NMR .

What substrates does BmrA transport, and how can transport activity be measured experimentally?

BmrA can transport various substrates including fluorescent dyes and antibiotics. Documented substrates include:

  • Hoechst 33342

  • Doxorubicin

  • 7-amino-actinomycin D (7-AAD)

The transport efficiency varies depending on the substrate, with 7-AAD being less efficiently transported compared to Hoechst 33342 and doxorubicin .

Transport activity can be measured using fluorescence-based assays that track the efflux of fluorescent substrates like Hoechst 33342. Additionally, researchers often couple transport measurements with ATPase activity assays to understand the relationship between ATP hydrolysis and substrate translocation . For mechanistic studies, researchers typically trap the transporter in specific conformational states using ATP analogs or transition-state analogs like vanadate (Vi), which together with ATP and Mg²⁺ (ATP:Mg²⁺:Vi) can lock the transporter in an outward-facing conformation .

How do conformational changes in BmrA's nucleotide-binding domains translate to the transmembrane domains during substrate transport?

The conformational coupling between NBDs and TMDs in BmrA follows a sophisticated mechanism essential for efficient substrate transport. Recent structural and spectroscopic studies have revealed that BmrA's NBDs function with a "tweezers-like" mechanism that is distinct from related transporters like the lipid A exporter MsbA .

Solid-state NMR investigations on BmrA reconstituted in lipids have identified specific chemical-shift differences between the inward-facing and outward-facing states induced by ATP:Mg²⁺:Vi addition . A key discovery is that the transition to the outward-facing state in wild-type BmrA involves a significant decrease in dynamics (stiffening) of a defined set of residues . This dynamic rigidification appears critical for efficiently transmitting conformational changes from the NBDs to the TMDs.

This finding was corroborated by studies on an X-loop mutant where ATPase and transport activities were uncoupled. In this mutant, ATP:Mg²⁺:Vi addition resulted in an incomplete transition to the outward-facing state, notably lacking the characteristic decrease in dynamics observed in wild-type BmrA . These results strongly suggest that the stiffening of specific residues is required for efficient transmission of conformational changes from the ATP-binding sites to the substrate translocation pathway.

What is the significance of the flexible-to-rigid transition in BmrA for substrate transport?

The flexible-to-rigid transition is central to BmrA's transport mechanism. Solid-state NMR studies have revealed that efficient substrate transport requires not just conformational changes but also alterations in protein dynamics . In wild-type BmrA, the transition from the inward-facing to outward-facing state upon ATP:Mg²⁺:Vi binding is accompanied by a significant decrease in dynamics (rigidification) of specific regions of the protein .

This dynamic rigidification appears to be essential for proper transmission of conformational signals from the NBDs to the TMDs. Evidence for this comes from experiments with an X-loop mutant where ATPase activity and transport were uncoupled. Although this mutant could bind and hydrolyze ATP, it failed to undergo the complete conformational and dynamic changes necessary for substrate transport . Specifically, the mutant lacked the characteristic decrease in dynamics observed in wild-type BmrA upon ATP:Mg²⁺:Vi addition.

The findings suggest a refined model for ABC transporters where changes in protein flexibility/rigidity, alongside conformational reorientations, are essential components of the transport mechanism. This dynamic aspect might be particularly important for accommodating diverse substrates of different sizes and chemical properties, as evidenced by the differential transport efficiency of various substrates like Hoechst 33342, doxorubicin, and 7-amino-actinomycin D .

How can cryo-EM and solid-state NMR be optimally utilized to study BmrA's conformational states?

Both cryo-electron microscopy (cryo-EM) and solid-state NMR have proven valuable for studying BmrA's conformational states, each offering unique advantages.

Solid-State NMR Approach:
Solid-state NMR offers unique insights into protein dynamics and local conformational changes that may not be captured by cryo-EM. For BmrA studies, the protein is typically reconstituted into lipids to maintain its native-like environment . This technique has been particularly valuable for:

  • Identifying chemical-shift differences between inward-facing and outward-facing states

  • Characterizing changes in protein dynamics associated with conformational transitions

  • Detecting local structural changes that might be missed in global structural analyses

How can fractional factorial design be applied to protein engineering studies of BmrA?

Fractional factorial design represents a powerful statistical approach for protein engineering that could be effectively applied to BmrA studies. This method allows researchers to systematically sample a large mutational space while minimizing the number of experiments required .

Methodological implementation for BmrA studies:

  • Identify key residues: Select residues in BmrA that are hypothesized to be important for function, such as those in the substrate-binding pocket, at the interface between NBDs and TMDs, or in the X-loop region known to affect coupling between ATPase and transport activities .

  • Design the factorial space: For n selected residues (factors), each with multiple possible mutations (levels), a full factorial design would require testing all possible combinations, resulting in an impractically large number of variants.

  • Create a fractional design: Instead of testing all combinations, develop a carefully selected subset based on statistical principles that exploit the "sparsity-of-effects principle," which posits that most effects in a system are due to single factors or low-order interactions .

  • Analyze results efficiently: The fractional factorial approach allows researchers to extract information about main effects (the effect of single mutations) and interactions between mutations with significantly fewer experiments.

The advantages of this approach for BmrA engineering include:

  • Reduction in experimental workload by a factor of several fold (potentially 8-fold or more) while still obtaining critical information about mutation effects

  • Ability to handle missing data points (failed mutations or expressions) without significant loss of information about main effects

  • Broader and more systematic sampling of the possible mutational space compared to random mutagenesis approaches

This approach would be particularly valuable for engineering BmrA variants with altered substrate specificity, enhanced transport efficiency, or improved stability for structural studies.

What insights have been gained from studying disulfide cross-linked BmrA mutants regarding the extent of NBD separation during the transport cycle?

Studies using disulfide cross-linked BmrA mutants have provided crucial insights into the conformational flexibility required during the transport cycle, particularly regarding NBD separation. Researchers introduced cysteine mutations near the C-terminal end of the NBDs to analyze the impact of disulfide-bond formation on BmrA function .

The key findings from these studies include:

  • Partial NBD separation is sufficient for many substrates: Surprisingly, the presence of a disulfide bond between the NBDs did not prevent ATPase activity nor did it affect the transport of substrates like Hoechst 33342 and doxorubicin . This indicates that complete separation of the NBDs is not necessary for the transport of these substrates.

  • Substrate-dependent requirements for NBD separation: While smaller substrates were efficiently transported by cross-linked BmrA, 7-amino-actinomycin D was less efficiently transported . This suggests that larger substrates may require a wider opening of the transporter for efficient translocation.

  • Evidence for a "tweezers-like" mechanism: Cryo-EM structures of both cross-linked mutant and wild-type BmrA in the apo state revealed similar configurations with intermediate opening between their NBDs while their C-terminal extremities remained in close proximity . This supports a tweezers-like mechanism for BmrA's NBDs that differs from the mechanism of related transporters like MsbA.

  • Validation through EPR spectroscopy: Distance measurements obtained by electron paramagnetic resonance spectroscopy confirmed the intermediate opening observed in the cryo-EM structures .

This research challenges the conventional model that ABC transporters require complete separation of their NBDs during the transport cycle. Instead, it suggests a more nuanced mechanism where the extent of NBD separation may vary depending on the substrate being transported and the specific transporter being studied.

What methodological approaches can be used to investigate the uncoupling between ATPase activity and transport function in BmrA mutants?

Investigating the uncoupling between ATPase activity and transport function in BmrA mutants requires a multi-faceted methodological approach. Based on studies of X-loop mutants where these functions were uncoupled , the following experimental strategies are recommended:

1. Parallel ATPase and Transport Assays:

  • ATPase Activity: Measure ATP hydrolysis rates using either colorimetric assays (e.g., malachite green) or radioisotope-based methods with γ-³²P-ATP.

  • Transport Assays: Simultaneously assess transport efficiency using fluorescent substrates like Hoechst 33342 or doxorubicin with real-time fluorescence measurements.

  • Comparative Analysis: Calculate the coupling ratio between ATP hydrolysis and substrate transport to quantify the degree of uncoupling in mutants compared to wild-type BmrA.

2. Structural Characterization of Conformational States:

  • Solid-State NMR: Analyze chemical shift differences between wild-type and mutant BmrA in different nucleotide-bound states (apo, ATP-bound, post-hydrolysis) when reconstituted in lipids .

  • Cryo-EM: Determine structures of mutants in various conformational states to identify structural differences that might explain functional uncoupling .

  • EPR Spectroscopy: Measure distances between strategically placed spin labels to track conformational changes in solution .

3. Dynamic Analysis:

  • NMR Relaxation Measurements: Assess changes in protein dynamics between wild-type and mutant BmrA, focusing on the flexible-to-rigid transition that appears crucial for proper transport function .

  • Hydrogen-Deuterium Exchange Mass Spectrometry: Map regions with altered conformational flexibility in uncoupled mutants.

4. Biochemical Cross-linking:

  • Disulfide Cross-linking: Introduce cysteine residues at strategic positions to trap the protein in specific conformations and assess the impact on ATPase and transport activities .

  • Photo-crosslinking: Use photoreactive amino acid analogs to capture transient protein-substrate interactions.

By combining these approaches, researchers can develop a comprehensive understanding of the structural, dynamic, and energetic factors that contribute to the coupling between ATP hydrolysis and substrate transport in BmrA, and how specific mutations can disrupt this coupling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.