Recombinant Bacillus subtilis Multidrug resistance protein ykkC (ykkC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Multidrug Resistance Protein ykkC

Bacillus subtilis is known to have seven homologues of the small multidrug resistance (SMR) family of drug efflux pumps within its genome . Many of these homologues are paired in three different operons . When one such operon, ykkCD, is co-expressed in Escherichia coli, it results in a multidrug-resistant phenotype that provides resistance to cationic, anionic, and neutral drugs . The ykkC motif is found across bacteria and is associated with SMR efflux pumps and ATP-binding cassette (ABC) transporters .

Functional Analysis and Multidrug Resistance

When both ykkC and ykkD genes are expressed together in E. coli strain DH5α, it leads to a broad-spectrum multidrug resistance (MDR) phenotype . This co-expression confers resistance to a range of toxic compounds, including cationic dyes, neutral antimicrobials, and anionic antimicrobials . The effect is more than ten times greater than the additive effect of the individual genes, which are essentially inactive when present alone .

The ykkC motif is hypothesized to be involved in responding to intracellular toxins by controlling the expression of efflux pumps and other proteins involved in detoxification .

DrugYkkCYkkDYkkC/YkkD
Phosphonomycin0.10.110

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If a particular tag is required, please specify this in advance, and we will prioritize its incorporation.
Synonyms
gdnC; ykkC; BSU13090; Probable guanidinium efflux system subunit GdnC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ykkC
Target Protein Sequence
MKWGLVVLAAVFEVVWVIGLKHADSALTWSGTAIGIIFSFYLLMKATHSLPVGTVYAVFT GLGTAGTVLSEIVLFHEPVGWPKLLLIGVLLIGVIGLKLVTQDETEEKGGEA
Uniprot No.

Target Background

Function

Function: Likely involved in guanidinium transport. In vitro studies indicate it confers resistance to a broad spectrum of toxic compounds, including cationic dyes and both neutral and anionic antimicrobials.

Database Links
Protein Families
Small multidrug resistance (SMR) protein family, YkkC/YkkD (TC 2.A.7.1.5) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Bacillus subtilis ykkC protein and what is its primary functional role?

ykkC is an SMR-type (small multidrug resistance) protein that functions as a subunit of the ykkCD efflux pump. According to the Comprehensive Antibiotic Resistance Database, ykkC is classified within the small multidrug resistance antibiotic efflux pump family . The protein's primary function is to work cooperatively with ykkD to form a functional membrane-embedded complex that exports a diverse range of antimicrobial compounds from the bacterial cell.

Research has conclusively demonstrated that ykkC alone cannot confer drug resistance. The functional unit requires both ykkC and ykkD proteins working in tandem. When co-expressed, these proteins create an efflux system capable of exporting various toxic compounds including cationic dyes and neutral and anionic antimicrobials . This cooperative mechanism represents an important paradigm in bacterial drug resistance systems.

How does the ykkCD efflux pump system work mechanistically?

The ykkCD efflux pump system operates through the coordinated action of two homologous SMR proteins, ykkC and ykkD, which must be co-expressed to form a functional multidrug efflux system. Jack et al. (2000) performed definitive experiments demonstrating that the co-expression of both ykkC and ykkD in Escherichia coli DH5α results in a broad-spectrum multidrug resistance phenotype that neither protein can confer when expressed individually .

The mechanistic operation involves:

  • Formation of a membrane-embedded heteromeric complex consisting of both ykkC and ykkD proteins

  • Recognition of diverse toxic compounds within the cytoplasm or membrane

  • Energy-dependent extrusion of these compounds across the cell membrane

  • Resulting resistance to a wide spectrum of antimicrobial agents

Transport studies revealed that expression of the ykkCD operon significantly inhibits ethidium bromide accumulation in bacterial cells, and this effect is abolished by the addition of carbonylcyanide m-chlorophenylhydrazone (20 μM) . This indicates that the ykkCD pump functions as a proton-dependent efflux system, utilizing the proton motive force across the membrane to drive export of toxic compounds.

What antimicrobial resistance profile is associated with the ykkC protein?

The ykkC protein, as part of the ykkCD efflux pump, contributes to multidrug resistance by enabling the export of diverse antimicrobial compounds. According to the Comprehensive Antibiotic Resistance Database, the ykkC efflux component is associated with resistance to several important drug classes:

  • Phenicol antibiotics

  • Tetracycline antibiotics

  • Aminoglycoside antibiotics

Specifically, the database links ykkC to resistance against chloramphenicol, tetracycline, and streptomycin .

Quantitative experimental data from Jack et al. (2000) demonstrates the dramatic effect of ykkC/ykkD co-expression on antimicrobial susceptibility, as shown in the following table:

Antimicrobial AgentControl MIC (μg/ml)YkkC MIC (μg/ml)YkkD MIC (μg/ml)YkkC/YkkD MIC (μg/ml)
Ethidium bromide252525400
Pyronin Y12.512.512.51,600
Phosphonomycin0.10.10.110

This data clearly demonstrates that co-expression increases resistance by 16-fold for ethidium bromide, 128-fold for pyronin Y, and 100-fold for phosphonomycin compared to either protein alone or control strains . This synergistic effect highlights the functional importance of the heteromeric complex in conferring robust antimicrobial resistance.

What is the genomic distribution of ykkC across bacterial species?

The ykkC protein shows a distinct phylogenetic distribution pattern with evolutionary implications. According to the Comprehensive Antibiotic Resistance Database, perfect matches to the ykkC sequence are found primarily in:

  • Bacillus subtilis genomes

While sequence variants (proteins with high similarity but not identical sequences) are documented in:

  • Bacillus halotolerans

  • Different strains of Bacillus subtilis

  • Bacillus tequilensis

This indicates that ykkC is well conserved within the Bacillus genus, with minor sequence variations between closely related species. More broadly, the SMR family to which ykkC belongs shows wide phylogenetic distribution. The Bacillus subtilis genome encodes seven homologues of the SMR family, with six of these homologues paired in three distinct operons . Similarly, the Escherichia coli genome encodes four such homologues (plus a plasmid-encoded homologue), and distant SMR homologues have been detected in diverse bacteria as well as in archaea and eukaryotes .

This pattern of gene organization, particularly the pairing of SMR genes in operons, appears to be a conserved genomic arrangement with functional significance, as demonstrated experimentally for the ykkCD pair.

How is the expression of ykkC regulated at the genetic level?

The expression of ykkC is regulated by a sophisticated riboswitch mechanism that responds specifically to guanidine levels. The ykkC riboswitch (now also designated as the guanidine-I riboswitch) functions as a molecular sensor for free guanidine, controlling the expression of genes involved in guanidine detoxification, including the ykkCD efflux pump .

This regulation occurs through the following molecular mechanism:

  • The riboswitch RNA folds into a specific three-dimensional structure capable of binding guanidine with high specificity

  • In the absence of guanidine, the riboswitch adopts a conformation that allows formation of a transcription terminator

  • When guanidine is present, it binds to the riboswitch pocket, causing a conformational change

  • This structural reorganization prevents terminator formation, allowing transcription to proceed

  • The result is increased expression of the ykkCD efflux pump and other detoxification enzymes

The ykkC riboswitch is primarily associated with genes encoding small multidrug resistance (SMR) efflux pumps and ATP-binding cassette (ABC) transporters . This regulatory arrangement suggests an integrated cellular response system that senses toxic guanidine levels and upregulates appropriate detoxification mechanisms, including the ykkCD efflux pump.

What is the structural basis for guanidine sensing by the ykkC family of riboswitches?

The structural basis for guanidine sensing by the ykkC riboswitch has been revealed through high-resolution crystallographic studies. According to research by Cornell University and Argonne National Laboratory, the 2.3 Å crystal structure of the guanidine-bound ykkC riboswitch from Dickeya dadantii provides detailed molecular insights into ligand recognition .

The riboswitch adopts a distinctive boot-shaped architecture with the following structural elements:

  • A coaxially stacked P1/P2 stem forming the "boot" portion

  • A 3'-P3 stem-loop forming the "heel"

  • Sophisticated base-pairing and cross-helix tertiary contacts creating a precisely shaped ligand-binding pocket between these structural elements

The guanidine molecule is recognized in its positively charged guanidinium form, in its sp² hybridization state, through multiple specific interactions:

  • A network of coplanar hydrogen bonds with the RNA nucleotides

  • A cation–π stacking interaction on top of a conserved guanosine residue

Isothermal titration calorimetry (ITC) experiments have quantified that the D. dadantii ykkC riboswitch binds guanidinium with an apparent dissociation constant (Kdapp) of 39 μM . The binding reaction is exothermic, with approximately 1:1 ligand–RNA stoichiometry, indicating a specific binding interaction rather than nonspecific association.

The riboswitch achieves remarkable selectivity by exploiting both the planar geometry and the positive charge of guanidinium for ligand discrimination. Structure-guided mutagenesis experiments confirm that disruption of the contacts involved in guanidinium recognition results in severe binding defects, validating the importance of these structural features for ligand recognition .

How does the mini-ykkC motif differ from the full ykkC riboswitch in structure and function?

The mini-ykkC motif represents a distinct class of guanidine-sensing riboswitches (designated guanidine-II riboswitches) that differs significantly from the full ykkC (guanidine-I) riboswitch in both structure and mechanism. Despite its extremely simple architecture, the mini-ykkC motif functions as an effective guanidine sensor .

The key differences include:

  • Structural organization:

    • The mini-ykkC motif consists of two stem loops with identical sequences

    • This contrasts with the more complex boot-shaped structure of the guanidine-I riboswitch

    • The mini-ykkC motif was initially considered a poor candidate for a riboswitch class due to its low structural complexity and limited number of conserved nucleotides

  • Binding mechanism:

    • Surprisingly, each of the two stem loops that comprise the mini-ykkC motif appears to directly bind free guanidine in a cooperative manner

    • This represents a distinct binding mechanism from the single binding pocket of the guanidine-I riboswitch

  • Regulatory targets:

    • The mini-ykkC motif commonly controls the expression of small multidrug resistance (SMR) family efflux pumps including those annotated as EmrE and SugE

    • It is also found in the intergenic region between urea carboxylase associated genes and urea carboxylase in putative guanidine degradation operons

    • While the guanidine-I riboswitch functions as a transcriptional 'ON' switch, the mini-ykkC is predicted to be a translational 'ON' switch that regulates expression by controlling access to the ribosome binding site

These differences illustrate the evolutionary diversity of riboswitch mechanisms that bacteria have developed to sense and respond to guanidine, with multiple independent solutions to the same molecular detection problem.

What experimental methods are most effective for studying ykkC protein function?

Several sophisticated experimental approaches have been established for investigating ykkC protein function, as evidenced by the methodologies described in the search results:

  • Heterologous Expression and Phenotypic Analysis:

    • Cloning and expression of ykkC alone or in combination with ykkD in E. coli

    • Systematic measurement of minimum inhibitory concentrations (MICs) using twofold dilution series of antimicrobial compounds

    • Comparative analysis of resistance profiles between control strains and those expressing ykkC, ykkD, or both

The protocol developed by Jack et al. (2000) provides a methodological framework:

  • PCR amplification of target genes using specific primers with engineered restriction sites

  • Cloning into arabinose-inducible expression vectors (pBAD24)

  • Transformation into E. coli DH5α

  • Expression induction with 0.2% arabinose

  • MIC determination using standardized dilution methods

  • Transport Activity Assays:

    • Monitoring accumulation of fluorescent substrates (e.g., ethidium bromide)

    • Assessing the effect of proton uncouplers (e.g., CCCP) on transport activity

    • Quantitative measurement of substrate efflux rates

  • Structural and Biochemical Studies:

    • Recombinant protein production and purification

    • Membrane reconstitution for functional assessment

    • Binding assays with fluorescent substrates

  • Genetic Approaches:

    • Site-directed mutagenesis to identify functionally critical residues

    • Gene knockout and complementation studies in native hosts

For researchers investigating the regulatory aspects, studies of the ykkC riboswitch have employed:

  • In-line probing to assess RNA structural changes upon ligand binding

  • Isothermal titration calorimetry (ITC) to quantify binding affinity

  • X-ray crystallography for high-resolution structural determination

These complementary approaches provide a comprehensive toolkit for investigating both the structural and functional aspects of the ykkC protein and its regulatory mechanisms.

How does the ykkC protein interact with ykkD to form a functional efflux system?

The interaction between ykkC and ykkD proteins to form a functional multidrug efflux system represents a crucial aspect of their antimicrobial resistance mechanism. The search results provide clear evidence for the functional requirement of both proteins, though the precise molecular details of their interaction remain to be fully characterized.

Key experimental observations include:

  • Neither ykkC nor ykkD alone confers measurable drug resistance when expressed individually in E. coli

  • Co-expression of both proteins results in a synergistic effect that produces resistance levels at least 10-fold greater than the additive effect of the individual proteins

  • The resistance spectrum when both proteins are co-expressed is exceptionally broad, covering cationic dyes and neutral and anionic antimicrobials

These observations strongly suggest that ykkC and ykkD form a heteromeric complex in the membrane with both proteins contributing essential elements to:

  • The substrate binding pocket

  • The transport pathway across the membrane

  • The energy coupling mechanism

The genomic organization of ykkC and ykkD as a single operon further supports their functional relationship . This pattern of paired SMR proteins appears to be common in B. subtilis, with six of the seven SMR homologues encoded as gene pairs in three distinct operons .

From a methodological perspective, researchers investigating this interaction should consider:

  • Co-immunoprecipitation or pull-down assays to biochemically verify direct interaction

  • Crosslinking studies to identify proximity relationships within the complex

  • Mutagenesis of putative interaction surfaces to disrupt complex formation

  • Structural studies (e.g., cryo-EM) of the assembled complex

What structural features distinguish ykkC from other members of the SMR family?

While the search results don't provide detailed structural information specifically about the ykkC protein, they do offer insights that allow inference of distinguishing features compared to other SMR family members:

  • Functional dependency on a partner protein:

    • Unlike some SMR proteins that function as homomultimers, ykkC requires its partner ykkD to form a functional efflux pump

    • This obligate heteromeric assembly represents a distinct structural and functional arrangement within the SMR family

  • Substrate diversity:

    • The ykkCD system confers resistance to an exceptionally broad range of toxic compounds compared to previously studied SMR pumps

    • This includes cationic, anionic, and neutral compounds, suggesting a unique substrate-binding pocket with versatile recognition properties

  • Genomic organization:

    • Six of the seven SMR homologues in B. subtilis are arranged in pairs, with ykkC and ykkD representing one such pair

    • This consistent pairing pattern suggests a conserved structural requirement for heteromeric assembly

  • Regulatory mechanism:

    • Expression of ykkC is controlled by a guanidine-sensing riboswitch

    • This specific regulatory mechanism links ykkC expression to guanidine detoxification, potentially indicating structural adaptations for guanidine and related compound transport

The remarkable 100-fold increase in phosphonomycin resistance and 128-fold increase in pyronin Y resistance when ykkC and ykkD are co-expressed suggests that their structural complementarity creates a highly efficient transport system with properties distinct from homomeric SMR transporters.

What methods can researchers use to express and purify recombinant ykkC for structural and functional studies?

For researchers aiming to produce recombinant ykkC protein for structural and functional studies, the search results suggest several methodological approaches:

Expression Systems:

  • Bacterial expression in E. coli:

    • The Jack et al. (2000) study successfully expressed ykkC in E. coli using the pBAD24 vector with an arabinose-inducible promoter

    • This system provides controlled expression through arabinose concentration adjustment

    • For structural studies, specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3)) would likely improve yields

Cloning Strategy:

  • PCR amplification with primers containing appropriate restriction sites:

    • For ykkC, primers used by Jack et al. (2000) were:

      • 5′-CATGCCATGGAATGGGGATTGGTCGTG-3′ (sense)

      • 5′-AAACTGCAGTTATGCCTCGCCTCCTTTTTCC-3′ (antisense)

    • These create NcoI and PstI restriction sites for directional cloning

  • Restriction enzyme digestion:

    • The PCR product is digested with NcoI and PstI enzymes

    • The expression vector is digested with the same enzymes

    • This allows directional insertion of the gene into the expression plasmid

  • Ligation and transformation:

    • The digested insert and vector are ligated

    • The ligation mixture is transformed into E. coli

    • Transformants are selected based on antibiotic resistance (e.g., ampicillin 50 μg/ml)

Expression Considerations:

  • For functional studies, co-expression with ykkD may be necessary to obtain the physiologically relevant complex

  • Addition of affinity tags (His, FLAG, etc.) would facilitate purification

  • Expression levels can be modulated by adjusting inducer concentration (0.2% arabinose was used by Jack et al.)

Commercial recombinant Bacillus subtilis multidrug resistance protein ykkC is available , indicating that established protocols for its expression and purification exist and can potentially be adapted by researchers for specific experimental needs.

How do mutations in the ykkC riboswitch affect guanidine binding and antimicrobial resistance?

Structure-guided mutagenesis studies of the D. dadantii ykkC riboswitch have provided valuable insights into the molecular determinants of guanidine binding and their consequent effects on gene regulation and antimicrobial resistance:

  • Binding affinity effects:

    • Mutations disrupting the tertiary contacts and ligand–RNA interactions in the riboswitch binding pocket significantly impact guanidine binding affinity as measured by isothermal titration calorimetry (ITC)

    • All tested mutations substantially decreased binding affinity, highlighting the precise structural requirements for riboswitch function

  • Structural basis:

    • The crystal structure reveals that guanidine is recognized through a network of coplanar hydrogen bonds and a cation–π stacking interaction

    • Disruption of these specific contacts through mutation severely impairs guanidine recognition

  • Regulatory consequences:

    • Since the ykkC riboswitch controls expression of the ykkCD efflux pump, mutations that impair guanidine binding would prevent the upregulation of this pump in response to guanidine exposure

    • This would result in decreased antimicrobial resistance under conditions where guanidine detoxification is required

  • Evolutionary implications:

    • The conservation of key nucleotides involved in guanidine binding across different bacterial species suggests strong selective pressure to maintain this sensing mechanism

    • This conservation underscores the biological importance of guanidine detection and response

From a methodological perspective, researchers investigating riboswitch function should consider combining:

  • Quantitative binding assays (ITC, fluorescence)

  • Structural analysis (X-ray crystallography, NMR)

  • Gene expression studies (reporter assays)

  • Phenotypic analysis of antimicrobial resistance

These integrated approaches can provide comprehensive understanding of how riboswitch mutations affect the entire regulatory pathway from ligand sensing to antimicrobial resistance.

What is the relationship between guanidine metabolism and ykkC-mediated antimicrobial resistance?

The search results reveal a sophisticated relationship between guanidine metabolism and ykkC-mediated antimicrobial resistance, highlighting an integrated cellular response system:

  • Guanidine as a cellular toxin:

    • Guanidine is a known denaturant at high concentrations and a strong base that ionizes to its positively charged form (guanidinium) in the intracellular environment

    • Bacteria have developed multiple pathways to minimize its toxic effects

  • Sensing mechanism:

    • The ykkC riboswitch (guanidine-I riboswitch) functions as a specific sensor for free guanidine

    • When guanidine binds to the riboswitch, it prevents formation of a transcription terminator, allowing expression of downstream genes

  • Coordinated response systems:

    • The ykkC riboswitch controls expression of the ykkCD efflux pump, which exports diverse toxic compounds

    • Mini-ykkC riboswitches (guanidine-II riboswitches) control other SMR family efflux pumps including those annotated as EmrE and SugE

    • These riboswitches also regulate genes encoding enzymes involved in guanidine metabolism:

      • Urea carboxylase and associated proteins

      • Allophanate hydrolase

  • Integrated metabolic and resistance pathways:

    • Genomic analysis reveals that mini-ykkC RNAs are encoded within apparent operons for a putative guanidine degradation pathway

    • These operons typically consist of genes for nitrate/sulfate/bicarbonate transporters, urea carboxylase associated proteins, urea carboxylase, and allophanate hydrolase

    • A guanidine-I riboswitch often appears at the beginning of these operons as a transcriptional 'ON' switch

    • Further into the operon, a mini-ykkC element may regulate expression of specific components

This integrated system reveals how bacteria coordinate multiple response mechanisms to guanidine exposure:

  • Export via efflux pumps (ykkCD and others)

  • Metabolic degradation via enzymatic pathways

  • Fine-tuned regulation of both systems through specialized riboswitches

This relationship demonstrates a sophisticated bacterial strategy where sensing of a specific toxic compound triggers coordinated expression of both efflux and metabolic detoxification systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.