Recombinant Bacillus subtilis Na (+)/H (+) antiporter subunit B

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Na⁺/H⁺ Antiporter Subunit B

The Bacillus subtilis Na⁺/H⁺ antiporter subunit B is a component of the mrp (multiple resistance and pH) operon, a multi-gene locus encoding a complex involved in Na⁺ resistance, alkali adaptation, and pH homeostasis . This operon comprises seven genes (mrpA to mrpG), which collectively form a multi-subunit Na⁺/H⁺ antiporter system. Subunit B (encoded by mrpB) is critical for the proper assembly and function of the antiporter, though its specific role remains partially characterized .

2.1. Genetic and Biochemical Features

The recombinant subunit B (UniProt accession: O05259) is a hydrophobic protein with a predicted membrane-spanning topology. Key features include:

  • Expression: Recombinant subunit B is produced in E. coli with an N-terminal His tag for purification .

  • Function: While mrpA is essential for Na⁺/H⁺ antiport activity, subunit B and other downstream genes (e.g., mrpF, mrpG) are required for optimal proton motive force-dependent transport and drug resistance .

2.2. Role in the mrp Operon

The mrp operon exhibits functional redundancy with other antiporters (e.g., TetA(L), NhaC) but is uniquely specialized for alkaline pH and high Na⁺ environments . Subunit B likely contributes to:

  • Proton Gradient Utilization: Electrogenic Na⁺ efflux driven by the transmembrane potential (ΔΨ) .

  • Cholate Efflux: Coupled with subunit F and G for multidrug resistance .

3.1. Expression and Purification

PropertyValue
Accession NumberO05259
Expression HostE. coli
TagN-terminal His tag
LengthFull-length (1–143 residues)
FunctionNa⁺/H⁺ antiporter subunit in multi-protein complex

Source: Creative Biomart (2025)

3.2. Functional Studies

  • Na⁺ Sensitivity: Mutants lacking mrpB or other subunits exhibit impaired Na⁺ resistance, particularly at alkaline pH (e.g., 0.03 M Na⁺ at pH 8.3) .

  • Antiport Mechanism:

    • Electrogenic Transport: Na⁺ efflux is driven by ΔΨ, as shown in membrane vesicle assays .

    • Subunit Dependency: Nonpolar mutations in mrpB disrupt antiporter activity, indicating its necessity for complex assembly .

4.1. mrp Operon Subunit Roles

SubunitProposed RoleExperimental Evidence
mrpACore Na⁺/H⁺ antiporter subunitPolar/nonpolar mutations abolish activity
mrpBStructural/functional supportRequired for optimal Na⁺ resistance
mrpFCholate efflux couplingMutants lose multidrug resistance
mrpGRegulatory or assembly factorAffects mrpF expression

4.2. Comparison with Other Antiporters

AntiporterOrganismKey FunctionSubunit Complexity
mrpB. subtilisNa⁺ resistance, pH homeostasis7 subunits
mnhS. aureusNa⁺ resistance6 subunits
NhaCB. subtilisNa⁺ uptake (minor role in pH)Single subunit

5.1. Unresolved Questions

  1. Structural Insights: Cryo-EM or X-ray crystallography data for subunit B are lacking.

  2. Regulation: How mrpB expression is coordinated with other subunits under stress.

  3. Evolutionary Context: Homology with proton-translocating NADH dehydrogenases suggests potential electron transport roles .

5.2. Potential Applications

  • Biotechnology: Engineering subunit B for enhanced Na⁺ tolerance in industrial strains.

  • Drug Development: Targeting multidrug efflux (via mrpF/G) in pathogenic bacteria .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize developing the specified tag.
Synonyms
mrpB; yufU; BSU31610; Na(+/H(+ antiporter subunit B; Mrp complex subunit B; Multiple resistance and pH homeostasis protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-143
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
mrpB
Target Protein Sequence
MNEQKTNDLILQTATKLVSFIILLFSFYLFLSGHNAPGGGFVGGLITSSSIVLLLLAYDL KTVRSLLPVNFIYVAGAGLLLAVLTGVGSFVFGAPFLTHTFGYFQLPILGKTELATATIF DLGVYLVVVGITMTIIQTIGEEE
Uniprot No.

Target Background

Function
Mrp complex is a Na(+)/H(+) antiporter that is considered to be the major Na(+) excretion system in B.subtilis. It plays a significant role in Na(+) resistance and a minor role in Na(+)- and K(+)-dependent pH homeostasis compared to TetB. While MrpA may be the actual Na(+)/H(+) antiporter, all six Mrp proteins are necessary for Na(+)/H(+) antiport activity and Na(+) resistance. MrpA is required for the initiation of sporulation when external Na(+) concentration increases. It also transports Li(+) but not K(+), Ca(2+) or Mg(2+).
Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the major Na(+)/H(+) antiporter systems identified in Bacillus subtilis?

Several distinct Na(+)/H(+) antiporter systems have been identified in B. subtilis, each with specific structural properties and physiological roles:

  • The Mrp (Multiple Resistance and pH adaptation) antiporter complex - a multi-subunit system with conserved glutamate residues essential for antiport activity

  • ShaA - considered the principal Na+ excretion system during vegetative growth

  • NhaG - present in strain ATCC9372 but missing in strain 168, containing 12 transmembrane domains

  • TetA(L) - a multifunctional antiporter that mediates tetracycline-cobalt/H+, Na+/H+, and K+/H+ exchange

The molecular diversity of these systems underscores their importance in maintaining ion homeostasis under various environmental conditions .

How does the structure of B. subtilis Na(+)/H(+) antiporter subunit B differ from other subunits?

The B. subtilis Mrp antiporter complex comprises multiple subunits that work together to facilitate ion exchange. While specific structural information about subunit B is limited in current literature, comparative analysis with homologous systems reveals that:

  • Subunit B likely contains transmembrane domains that contribute to the ion translocation pathway

  • Unlike MrpA, which has additional transmembrane regions at the carboxy terminus similar to NuoL subunits, subunit B has a more compact structure

  • The subunit contains conserved charged residues (particularly glutamate and lysine) that participate in forming the ion channel

  • Functional studies suggest subunit B cooperates with other subunits, particularly A and D, which have been shown to contain conserved glutamate residues essential for antiporter activity .

What is the physiological significance of Na(+)/H(+) antiporters in B. subtilis?

Na(+)/H(+) antiporters in B. subtilis serve multiple critical physiological functions:

  • Maintenance of cytoplasmic pH homeostasis, particularly under alkaline conditions

  • Regulation of intracellular Na+ concentrations to prevent toxicity

  • Contribution to membrane potential and energy transduction

  • Support of sporulation processes under varying salt concentrations

  • Resistance to antimicrobial compounds in some antiporter systems (e.g., TetA(L))

Research has demonstrated that disruption of the ShaA Na(+)/H(+) antiporter impairs sporulation when external Na+ concentration increases, highlighting the essential role these systems play in developmental processes . Additionally, the TetA(L) antiporter has been shown to participate in both Na+- and K+-dependent pH homeostasis and Na+ resistance during growth at alkaline pH .

What are the optimal methods for recombinant expression of B. subtilis Na(+)/H(+) antiporter subunit B?

Successful recombinant expression of B. subtilis Na(+)/H(+) antiporter subunit B requires careful optimization of several parameters:

  • Expression System Selection:

    • E. coli BL21(DE3) with pET-based vectors for high-yield expression

    • B. subtilis expression systems for proper folding and post-translational modifications

    • Consider specialized expression strains for membrane proteins (e.g., C41(DE3) or C43(DE3))

  • Construct Design:

    • Incorporate affinity tags (hexahistidine) for purification

    • Consider fusion proteins to enhance solubility

    • Codon optimization for the expression host

  • Induction Conditions:

    • Lower temperatures (16-25°C) often improve proper folding

    • IPTG concentration typically between 0.1-0.5 mM

    • Extended induction times (overnight) at lower temperatures

  • Membrane Protein Extraction:

    • Gentle lysis methods to preserve protein structure

    • Detergent screening (DDM, LDAO, CHAPS) for optimal solubilization

    • Gradient centrifugation for membrane fraction isolation

The successful purification of TetA(L) with a hexahistidine tag and its functional reconstitution into proteoliposomes provides a valuable methodological precedent for other B. subtilis antiporter subunits .

What assays are most reliable for measuring Na(+)/H(+) antiporter activity of recombinant subunit B?

Several complementary approaches can be employed to assess the antiporter activity of recombinant subunit B:

  • Proteoliposome-Based Assays:

    • Reconstitution of purified protein into artificial liposomes

    • Creation of artificial ion gradients (typically pH)

    • Monitoring ion flux using fluorescent probes (ACMA, pyranine) or radiolabeled substrates

    • This approach has been successfully used for TetA(L), demonstrating high activities of various antiport functions

  • Whole-Cell Transport Assays:

    • Using E. coli Na+/H+ antiporter-deficient mutants complemented with the recombinant protein

    • Measuring growth under sodium stress conditions

    • Quantifying intracellular Na+ levels using atomic absorption spectroscopy or sodium-sensitive fluorescent dyes

  • Electrophysiological Methods:

    • Patch-clamp analysis of proteoliposomes or cells expressing the recombinant protein

    • Solid-supported membrane (SSM)-based electrophysiology

    • These approaches can provide evidence for the electrogenicity of antiport, as demonstrated for TetA(L)

  • pH Homeostasis Assays:

    • Monitoring internal pH changes using pH-sensitive fluorescent probes

    • Assessing recovery from acid or alkaline load in the presence of sodium

How can researchers address solubility challenges when working with recombinant membrane antiporter proteins?

Membrane proteins like Na(+)/H(+) antiporter subunits present significant solubility challenges that can be addressed through several strategies:

  • Detergent Optimization:

    • Systematic screening of detergent types (non-ionic, zwitterionic, ionic)

    • Testing detergent concentrations above critical micelle concentration

    • Using detergent mixtures for improved extraction efficiency

    • Considering newer amphipathic polymers (amphipols, SMALPs) for native-like environments

  • Protein Engineering Approaches:

    • Truncation of flexible or hydrophobic regions

    • Introduction of solubility-enhancing mutations

    • Fusion with solubility-enhancing partners (MBP, SUMO, Trx)

    • Creation of chimeric constructs with well-expressed homologs

  • Expression Conditions:

    • Reduced expression rates to allow proper membrane insertion

    • Co-expression with chaperones to assist folding

    • Use of specialized membrane protein expression strains

  • Alternative Solubilization Methods:

    • Nanodiscs for a more native-like lipid environment

    • Bicelles for structural studies

    • Cell-free expression systems with direct incorporation into liposomes

How does c-di-AMP regulation interface with Na(+)/H(+) antiporter function in B. subtilis?

The second messenger cyclic-di-AMP (c-di-AMP) plays a central role in modulating ion homeostasis in B. subtilis through multiple mechanisms that intersect with Na(+)/H(+) antiporter function:

  • Regulatory Network Integration:

    • c-di-AMP controls the levels of intracellular K+ by regulating transcription and activity of K+ channels and transporters

    • This K+ regulation indirectly affects Na+ homeostasis due to the interrelated nature of these cationic systems

    • The c-di-AMP signaling pathway may directly modulate Na(+)/H(+) antiporter activity through protein-protein interactions or post-translational modifications

  • Hierarchical Organization:

    • Similar to its influence on RCK proteins (KtrA and KtrC) that regulate K+ channels, c-di-AMP likely establishes hierarchical organization among Na(+)/H(+) antiporter systems

    • This hierarchical control ensures appropriate antiporter system engagement under specific environmental conditions

  • Experimental Approaches to Study this Interface:

    • c-di-AMP binding assays with purified antiporter subunits

    • Phenotypic analysis of c-di-AMP synthase or phosphodiesterase mutants under Na+ stress

    • Transcriptomic and proteomic analysis to identify co-regulated systems

    • In vitro reconstitution systems with controlled c-di-AMP levels

The emerging understanding of this regulatory network has significant implications for bacterial stress responses and adaptation mechanisms.

What structural and functional differences exist between the various Na(+)/H(+) antiporter systems in B. subtilis?

The Na(+)/H(+) antiporter systems in B. subtilis exhibit distinct structural and functional characteristics:

Antiporter SystemStructureSubstrate SpecificityRegulationPhysiological Roles
Mrp ComplexMulti-subunit system with conserved glutamate residuesNa+/H+ exchange; possible additional ion specificitiesResponsive to pH and salt stresspH homeostasis, Na+ detoxification
ShaASingle polypeptidePrimary Na+/H+ antiporterExpressed during vegetative growthMajor Na+ excretion system; required for sporulation under Na+ stress
NhaG12 transmembrane domains with long C-terminal hydrophilic stretchNa+/H+ exchangePresent in strain ATCC9372 but missing in strain 168Na+ extrusion, pH regulation
TetA(L)14-transmembrane segment transporterTetracycline-cobalt/H+, Na+/H+, and K+/H+ antiportInduced by tetracyclineAntibiotic resistance, pH homeostasis, Na+ resistance during growth at alkaline pH

The structural diversity among these systems enables B. subtilis to respond to various environmental challenges. TetA(L), for example, represents a multifunctional antiporter capable of transporting both complex organic substrates and monovalent cations, with evidence suggesting distinct binding domains for these different substrates .

How do mutations in conserved residues of antiporter subunit B affect ion selectivity and transport kinetics?

Site-directed mutagenesis studies of conserved residues in Na(+)/H(+) antiporter subunits have revealed critical insights about structure-function relationships:

  • Conserved Charged Residues:

    • Glutamate residues in MrpA and MrpD subunits are highly conserved and essential for antiport activity

    • Mutation of these residues typically results in complete loss or significant reduction of transport activity

    • These charged residues likely form part of the ion translocation pathway, similar to their role in the homologous Nuo subunits of respiratory complex I

  • Effects on Ion Selectivity:

    • Mutations in specific transmembrane domains can alter ion selectivity between Na+, K+, and Li+

    • Experimental evidence from TetA(L) shows that K+ and Li+ inhibit Na+ uptake, suggesting overlapping but distinct binding sites

    • Charge-neutralizing mutations often have more dramatic effects than conservative substitutions

  • Transport Kinetics Alterations:

    • Mutations typically affect Vmax more significantly than Km

    • Electrogenicity of transport (as demonstrated for TetA(L) Na+/H+ antiport ) can be modified by specific mutations

    • Stoichiometry changes may occur with mutations at key residues

  • Methodological Approaches:

    • Proteoliposome-based assays with artificial pH gradients

    • Direct measurement of ion fluxes using radioisotopes or ion-selective electrodes

    • Electrophysiological methods to quantify transport rates and electrogenicity

How should researchers address contradictory findings regarding Na(+)/H(+) antiporter subunit activity across different B. subtilis strains?

Contradictory findings regarding Na(+)/H(+) antiporter activity across B. subtilis strains often stem from strain-specific genetic differences, as exemplified by the nhaG gene present in strain ATCC9372 but absent in strains 168 and 160 . Researchers should implement the following strategies:

  • Comprehensive Strain Characterization:

    • Complete genome sequencing to identify strain-specific genes

    • Southern blot analysis for specific antiporter genes, as performed for nhaG

    • Detailed documentation of strain provenance and maintenance history

  • Standardized Experimental Conditions:

    • Consistent growth media composition, particularly regarding Na+ and K+ concentrations

    • Uniform pH measurement and control methods

    • Standardized protein expression and assay protocols

  • Complementation Studies:

    • Cross-complementation between strains to identify functional equivalence

    • Generation of knockout mutants to establish gene-function relationships

    • Expression of individual antiporter components in heterologous hosts

  • Meta-analysis Approaches:

    • Systematic comparison of published results with standardized reporting

    • Statistical analysis accounting for strain differences

    • Development of strain-specific reference datasets

The case of nhaG, which is sandwiched by two identical TTTTCTT sequences in strain ATCC9372 but missing in strain 168, illustrates how mobile genetic elements can contribute to strain-specific differences in antiporter systems .

What are the best approaches for analyzing the stoichiometry and electrogenicity of Na(+)/H(+) antiport mediated by recombinant subunit B?

Determining the stoichiometry and electrogenicity of Na(+)/H(+) antiport requires sophisticated biophysical techniques:

  • Stoichiometry Determination:

    • Simultaneous measurement of Na+ and H+ fluxes using ion-selective electrodes or fluorescent probes

    • Isotope exchange experiments with radiolabeled Na+

    • Analysis of Hill coefficients from kinetic data

    • For complex substrates like tetracycline-cobalt in TetA(L), direct measurement has confirmed a 1:1 transport ratio

  • Electrogenicity Assessment:

    • Membrane potential measurements using voltage-sensitive dyes

    • Electrophysiological recordings from proteoliposomes

    • Solid-supported membrane (SSM)-based electrophysiology

    • Analysis of transport activity under varying membrane potential conditions

    • TetA(L) has been shown to exhibit electrogenic transport for both tetracycline-cobalt/H+ and Na+/H+ antiport

  • Data Analysis Frameworks:

    • Application of enzyme kinetics models adapted for transport processes

    • Use of thermodynamic constraints to validate stoichiometry proposals

    • Integration of structural data with functional measurements

    • Computer modeling of ion translocation pathways

  • Technical Considerations:

    • Careful pH control and buffering capacity assessment

    • Accounting for background ion leakage in artificial systems

    • Ensuring protein orientation consistency in reconstituted systems

    • Statistical analysis of replicate measurements

How can researchers differentiate between direct and indirect effects when studying the impact of environmental factors on antiporter activity?

Distinguishing direct from indirect effects on antiporter activity requires methodical experimental design:

  • In Vitro Reconstitution Systems:

    • Purified protein reconstituted into proteoliposomes provides a controlled environment

    • Direct examination of antiporter activity in the absence of cellular components

    • Systematic variation of individual parameters (pH, ion concentrations)

    • This approach has been successful with TetA(L), demonstrating its direct multifunctional transport capabilities

  • Genetic Dissection Strategies:

    • Construction of specific genetic backgrounds lacking potential regulatory factors

    • Site-directed mutagenesis of suspected regulatory sites

    • Complementation analyses with wild-type and mutant versions

    • The ShaA studies demonstrated its specific role in sporulation separate from vegetative growth effects

  • Time-Resolved Measurements:

    • Kinetic analysis to separate rapid (direct) from slower (indirect) effects

    • Pulse-chase experiments to track ion movements

    • Real-time monitoring of multiple cellular parameters simultaneously

  • Multi-Omics Integration:

    • Correlation of transport activity with transcriptomic, proteomic, and metabolomic changes

    • Network analysis to identify causal relationships

    • Comparison across multiple environmental perturbations

  • Control Experiments:

    • Use of specific inhibitors when available

    • Generation of transport-inactive mutants as negative controls

    • Comparison with heterologous transporters with known mechanisms

What emerging technologies might advance our understanding of Na(+)/H(+) antiporter subunit interactions and assembly?

Several cutting-edge technologies show promise for elucidating Na(+)/H(+) antiporter subunit interactions:

  • Advanced Structural Biology Approaches:

    • Cryo-electron microscopy for high-resolution structures of complete antiporter complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Integrative structural biology combining multiple data sources (X-ray, NMR, SAXS)

  • In-Cell Structural and Interaction Studies:

    • Förster resonance energy transfer (FRET) with specifically positioned fluorophores

    • Single-molecule tracking in living cells

    • Crosslinking mass spectrometry for capturing transient interactions

    • Genetic code expansion for site-specific incorporation of photo-crosslinkers

  • Systems Biology Approaches:

    • Comprehensive genetic interaction mapping (synthetic lethality screens)

    • Global protein-protein interaction networks under varying conditions

    • Multi-scale modeling integrating molecular dynamics with cellular physiology

  • Functional Imaging Techniques:

    • Ion-specific fluorescent probes with subcellular resolution

    • Correlative light and electron microscopy to connect structure and function

    • Super-resolution microscopy to visualize antiporter distribution and dynamics

How might insights from B. subtilis Na(+)/H(+) antiporters inform therapeutic strategies against pathogenic bacteria?

Knowledge of B. subtilis Na(+)/H(+) antiporters has significant translational potential:

  • Antibiotic Development Opportunities:

    • Targeting conserved antiporter structures present in pathogenic bacteria

    • Exploiting differences between bacterial and human Na+/H+ exchangers

    • Development of combination therapies targeting both antiporters and related systems

    • The multifunctional nature of TetA(L), which combines antibiotic efflux with ion transport , suggests potential vulnerabilities

  • Virulence Attenuation Strategies:

    • Disruption of pH homeostasis required for virulence factor expression

    • Targeting Na+ homeostasis systems essential for host colonization

    • Modulation of c-di-AMP signaling networks that regulate antiporter function

  • Research Methodologies:

    • B. subtilis as a model system for screening antiporter inhibitors

    • Structure-based drug design targeting conserved antiporter features

    • High-throughput phenotypic screening using ion-sensitive reporters

  • Resistance Mechanism Insights:

    • Understanding how antiporter systems contribute to intrinsic antibiotic resistance

    • Identifying resistance mechanisms that might emerge against new therapeutics

    • Developing strategies to circumvent resistance through multi-target approaches

The understanding that c-di-AMP regulates ion homeostasis machinery in many bacterial pathogens provides a promising avenue for therapeutic intervention targeting these signaling networks .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.