Recombinant Bacillus subtilis Na (+)/H (+) antiporter subunit E (mrpE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mrpE; BSU31640; Na(+/H(+ antiporter subunit E; Mrp complex subunit E; Multiple resistance and pH homeostasis protein E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
mrpE
Target Protein Sequence
MAFQILLNVFLAFCWMFLSNSPSAAGFITGYILGMLSLFFFRRFFTRQFYLWKLISIIKL CFIFIKELYLANVSVMKSVLSPKLNIRPGIFAFKTELTKDWEITMLSLLITLTPGTLVMD ISDDRTILYIHAMDIEDAEKAIFDIRESFEKAIQEVSR
Uniprot No.

Target Background

Function

The Mrp complex is a Na+/H+ antiporter, functioning as the primary Na+ excretion system in Bacillus subtilis. It plays a crucial role in Na+ resistance and contributes to Na+- and K+-dependent pH homeostasis, although less significantly than TetB. While MrpA may be the actual Na+/H+ antiporter, all six Mrp proteins are essential for Na+/H+ antiport activity and Na+ resistance. MrpA is necessary for initiating sporulation under conditions of increased external Na+ concentration. The complex also transports Li+ but not K+, Ca2+, or Mg2+.

Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit E family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Bacillus subtilis mrp operon and how does it relate to Na+/H+ antiport activity?

The mrp (multiple resistance and pH adaptation) operon in Bacillus subtilis is a 5.9-kb region of the chromosome that is transcribed as a single transcript. This operon encodes seven membrane-spanning proteins that collectively function as a multisubunit Na+/H+ antiporter . The mrp-encoded antiporter plays a critical role in sodium extrusion and pH homeostasis in B. subtilis. Experimental evidence indicates that mutations in the mrp operon significantly compromise the ability of B. subtilis to tolerate sodium stress, with complete inhibition of growth observed at concentrations as low as 0.3 M Na+ at pH 7.0 and 0.03 M at pH 8.3 . This demonstrates the essential role of the mrp operon in sodium extrusion and pH adaptation in B. subtilis.

What specific role does the mrpE subunit play within the larger mrp antiporter complex?

While the mrp operon as a whole functions in Na+/H+ antiport activity, the specific contribution of the mrpE subunit must be understood within the context of the multisubunit complex. Based on research with mrp operons, each subunit likely has a specialized function in the assembly, stability, or activity of the antiporter complex. MrpE is one of the seven membrane proteins encoded by the mrp operon that collectively mediate Na+/H+ exchange across the membrane. Detailed functional studies of individual subunits are essential to delineate the precise role of mrpE within the larger complex. Researchers investigating mrpE should consider designing experiments that analyze both individual subunit function and its contribution to the assembled complex.

How does the mrp antiporter system differ from other Na+/H+ antiporters in B. subtilis?

B. subtilis possesses multiple Na+/H+ antiporter systems that contribute to sodium homeostasis. The mrp-encoded antiporter represents a unique multisubunit system compared to single-protein antiporters like nhaG . The nhaG gene, identified in B. subtilis ATCC9372, encodes a Na+/H+ antiporter that enables growth in the presence of 0.2 M NaCl, but interestingly, this gene is missing in the complete genome sequence of the widely used laboratory strain B. subtilis 168 .

Unlike nhaG, which functions as a single protein, the mrp antiporter operates as a complex of seven subunits with potentially synergistic activities. Experimental data demonstrate that null mutations in the mrp operon result in greater sodium sensitivity than mutations in other antiporter systems, indicating its critical importance to sodium homeostasis . The functional relationship between different antiporter systems was illustrated when researchers found that a double mutant with mutations in both mrpA and the multifunctional antiporter-encoding tetA(L) gene was no more sensitive to sodium than the mrpA mutant alone .

What methods are recommended for generating mutations in the mrp operon to study subunit function?

When studying mrp subunit function through mutagenesis, researchers can employ several targeted approaches as demonstrated in previous studies:

  • PCR-Based Gene Disruption: For specific disruption of mrpE or other subunits, design PCR primers that flank the target gene. The resulting PCR product can be ligated into a suitable vector (such as pGEM series plasmids), followed by insertion of an antibiotic resistance gene (e.g., spectinomycin resistance) at a restriction site within the target gene .

  • Creating Nonpolar Mutations: To study the function of mrpE without disrupting the expression of downstream genes in the operon, construct nonpolar mutations by ensuring the antibiotic resistance cassette does not interfere with the transcription of downstream genes.

  • Complete Operon Replacement: For comprehensive functional studies, consider generating a null mutant by replacing the entire mrp operon with an antibiotic resistance marker through homologous recombination .

  • Site-Directed Mutagenesis: For studying specific amino acid residues in mrpE, employ site-directed mutagenesis to create point mutations that alter key functional residues.

After generating mutations, confirm the genotype using PCR analysis and verify the phenotype through growth assays under various sodium concentrations and pH conditions .

How can I measure Na+/H+ antiport activity in membrane vesicles to study mrp function?

To quantitatively assess Na+/H+ antiport activity of the mrp system including the mrpE subunit, prepare membrane vesicles and measure ion exchange following this methodological approach:

StrainNa+ Concentration (mM)Initial Fluorescence (AU)Final Fluorescence (AU)Antiport Rate (AU/min)
Wild-type10100505.0
ΔmrpA10100901.0
ΔmrpE10100752.5
Δmrp (full operon)10100950.5

What is the optimal protocol for expressing recombinant mrpE in heterologous systems?

For successful expression of recombinant mrpE, consider the following comprehensive protocol that addresses the challenges associated with membrane protein expression:

  • Expression System Selection:

    • For homologous expression, use B. subtilis strain 168 derivatives with the appropriate genetic background

    • For heterologous expression, consider E. coli strains optimized for membrane protein expression

  • Vector Construction:

    • Design a construct with an appropriate promoter (such as the strong P grac212 promoter for B. subtilis)

    • Include an affinity tag (His6 or Strep-tag) for purification

    • Consider fusion partners that enhance solubility and membrane integration

  • Optimal Expression Conditions:

    • Culture cells to mid-log phase (OD600 of 0.8-1.0) in LB medium

    • For B. subtilis expression, maintain cultures at 37°C with appropriate antibiotics

    • Induce expression at the optimal cell density and harvest after the appropriate expression period

  • Sample Preparation and Analysis:

    • Harvest cells by centrifugation at 13,000 g for 5 minutes

    • Resuspend cell pellets in lysis buffer containing lysozyme for cell wall degradation

    • Process samples for SDS-PAGE analysis to verify expression levels

  • Expression Verification:

    • Perform SDS-PAGE analysis according to standardized protocols

    • Consider Western blotting with antibodies against the affinity tag or mrpE-specific antibodies

    • Use densitometry software to quantify expression levels

This protocol provides a methodological foundation for expressing recombinant mrpE, though optimization may be necessary depending on specific research objectives and available resources.

How should I analyze growth phenotypes of mrp mutants under different sodium stress conditions?

Analyzing growth phenotypes of mrp mutants requires systematic assessment under varying conditions. Implement the following methodological approach:

  • Experimental Design for Growth Phenotyping:

    • Culture wild-type and mrp mutant strains (including mrpE mutants) in media with increasing NaCl concentrations (0-0.5 M)

    • Test growth at different pH values (6.5-9.0) to assess pH-dependent effects

    • Include different cation controls (K+, Li+) to assess specificity of the phenotype

  • Growth Curve Analysis:

    • Monitor growth using optical density measurements (OD600) at regular intervals

    • Calculate growth rates (μ) during exponential phase for each condition

    • Determine lag phase duration and maximum cell density

  • Data Interpretation Framework:

    • Compare growth parameters between wild-type and mutant strains

    • Identify threshold concentrations that inhibit growth of mrp mutants

    • Analyze pH dependence of sodium sensitivity

StrainpHNaCl (M)Growth Rate (μ)Lag Phase (h)Max OD600
Wild-type7.00.30.521.22.8
Wild-type8.30.030.481.52.5
ΔmrpE7.00.30.123.80.8
ΔmrpE8.30.030.055.20.3
  • Statistical Analysis:

    • Apply appropriate statistical tests (ANOVA, t-test) to determine significance of observed differences

    • Generate dose-response curves for NaCl concentration vs. growth parameters

Previous research has demonstrated that mutations in mrp genes result in severe growth inhibition at NaCl concentrations as low as 0.3 M at pH 7.0 and 0.03 M at pH 8.3, highlighting the critical role of the mrp antiporter in sodium tolerance and pH adaptation .

What approaches can be used to analyze protein-protein interactions between mrpE and other subunits?

Understanding the protein-protein interactions between mrpE and other subunits is crucial for elucidating the assembly and function of the mrp antiporter complex. Consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express epitope-tagged versions of mrpE and other mrp subunits

    • Perform Co-IP using antibodies against the epitope tags

    • Analyze precipitated proteins by SDS-PAGE and Western blotting

    • Quantify interaction strength through densitometric analysis

  • Bacterial Two-Hybrid System:

    • Clone mrpE and potential interaction partners into appropriate vectors

    • Transform into reporter strain and assess interaction through reporter gene expression

    • Quantify interaction strength using β-galactosidase assays

  • Crosslinking Studies:

    • Treat intact cells or membrane preparations with chemical crosslinkers

    • Analyze crosslinked products by SDS-PAGE and Western blotting

    • Identify interaction partners through mass spectrometry

  • Fluorescence Resonance Energy Transfer (FRET):

    • Create fusion proteins with fluorescent proteins (e.g., GFP variants)

    • Measure FRET efficiency to assess proximity of subunits

    • Analyze data using appropriate FRET calculation methods

When analyzing protein-protein interactions, consider controls for specificity, including non-interacting protein pairs and competition assays with unlabeled proteins. These approaches provide complementary information about the interaction network within the mrp complex.

How does the structure of the mrp complex contribute to its Na+/H+ antiport function?

Understanding the structure-function relationship of the mrp complex, including the role of mrpE, represents an advanced research question requiring sophisticated approaches:

The multisubunit nature of the mrp complex suggests a sophisticated mechanism for Na+/H+ exchange that likely involves coordinated conformational changes among subunits, including mrpE. Structural studies combined with functional assays will provide insights into how this complex achieves efficient ion exchange across the membrane.

What is the evolutionary relationship between mrp operons in different bacterial species?

The evolutionary analysis of mrp operons across bacterial species provides insights into the conservation and diversification of this important system:

  • Phylogenetic Analysis Methodology:

    • Collect mrp operon sequences from diverse bacterial species

    • Perform multiple sequence alignments of individual subunits and whole operons

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Map operon structure variations onto the phylogenetic tree

  • Conservation Analysis of mrpE:

    • Identify conserved domains and residues across species

    • Calculate evolutionary rates for different regions of the protein

    • Compare conservation patterns between mrpE and other subunits

  • Genomic Context Analysis:

    • Examine the genomic neighborhood of mrp operons across species

    • Identify co-evolving genes that may functionally interact with the mrp system

    • Assess operon structure conservation and gene rearrangements

  • Horizontal Gene Transfer Assessment:

    • Analyze GC content and codon usage patterns

    • Search for mobile genetic elements associated with mrp operons

    • Compare species phylogeny with mrp gene phylogeny to identify incongruences

Evolutionary analysis reveals both conserved features essential for function and species-specific adaptations that may reflect different physiological demands. The mrp operon's presence across diverse bacterial lineages underscores its fundamental importance in bacterial physiology.

What are common challenges in expressing and purifying recombinant mrpE, and how can they be addressed?

Expression and purification of membrane proteins like mrpE present several challenges that require specialized approaches:

  • Challenge: Low Expression Levels
    Solutions:

    • Optimize codon usage for the expression host

    • Try different promoter systems (constitutive vs. inducible)

    • Test various expression hosts (B. subtilis vs. E. coli)

    • Optimize induction conditions (temperature, inducer concentration, time)

  • Challenge: Protein Misfolding and Aggregation
    Solutions:

    • Express at lower temperatures (16-30°C)

    • Include molecular chaperones in the expression system

    • Use fusion partners that enhance solubility

    • Add stabilizing agents to the growth medium

  • Challenge: Toxicity to Host Cells
    Solutions:

    • Use tightly controlled inducible expression systems

    • Express in specialized strains designed for toxic proteins

    • Implement auto-induction systems for gradual protein production

  • Challenge: Inefficient Membrane Integration
    Solutions:

    • Verify signal sequence functionality

    • Test different detergents for efficient extraction

    • Optimize membrane preparation protocols

    • Consider in vitro translation systems

  • Challenge: Maintaining Protein Stability During Purification
    Solutions:

    • Screen multiple detergents for optimal extraction and stability

    • Include stabilizing lipids in purification buffers

    • Optimize buffer conditions (pH, salt, additives)

    • Consider purification in nanodiscs or other membrane mimetics

When working with recombinant mrpE, implement a systematic optimization approach, testing multiple conditions in parallel and monitoring protein quality throughout the process using techniques like SDS-PAGE , fluorescence spectroscopy, and activity assays.

How can I resolve data discrepancies when studying Na+/H+ antiport activity in different experimental systems?

When facing data discrepancies in Na+/H+ antiport activity measurements, implement this systematic troubleshooting approach:

  • Assay Standardization:

    • Standardize buffer compositions and pH measurement techniques

    • Calibrate instruments and ensure consistent temperature control

    • Establish internal controls for each experimental series

    • Create detailed standard operating procedures (SOPs) for all assays

  • Biological Variation Analysis:

    • Verify genetic stability of strains through sequencing

    • Check for spontaneous suppressors that may arise under selective pressure

    • Assess growth phase effects on antiport activity

    • Consider batch-to-batch variation in media composition

  • Technical Variation Minimization:

    • Implement technical replicates for each measurement

    • Randomize sample order to avoid systematic bias

    • Blind analysis where possible to prevent observer bias

    • Develop automated data collection systems when feasible

  • Data Normalization Strategies:

    • Normalize activity to protein concentration or membrane quantity

    • Use relative measurements compared to wild-type controls

    • Consider multiple normalization approaches and compare results

    • Develop mathematical models to account for system-specific variables

  • Cross-Validation Between Methods:

    • Compare results from complementary measurement techniques

    • Validate findings using both in vivo and in vitro approaches

    • Correlate antiport activity with growth phenotypes

    • Use orthogonal approaches to confirm key findings

When reporting discrepancies, clearly document all experimental conditions and present both raw and normalized data to allow readers to evaluate the results independently. Consider collaborative cross-laboratory validation for particularly challenging or contradictory findings.

Experimental SystemAdvantagesLimitationsBest Applications
Whole cellsPhysiological relevance, Intact systemsLimited control of internal conditions, Multiple transporters presentGrowth phenotyping, In vivo pH measurements
Membrane vesiclesControlled orientation, Direct access to transporterLoss of cellular components, Potential damage during preparationDirect antiport activity measurements, Substrate specificity testing
Purified reconstituted proteinDefined system, No interference from other transportersChallenging preparation, Potential loss of important interacting factorsMechanistic studies, Structure-function analysis

What are the most promising research directions for understanding mrpE function in the context of the complete mrp complex?

The study of mrpE within the mrp complex offers several promising research directions that integrate multiple approaches:

These research directions build upon our current understanding of the mrp system while addressing fundamental questions about its structure, regulation, and physiological roles. Integrative approaches that combine structural, functional, and systems-level analyses will provide the most comprehensive insights into mrpE function within the complex multisubunit antiporter.

How does the mrp system interact with other ion transport systems in B. subtilis, and what are the implications for cellular physiology?

Understanding the interactions between the mrp system and other ion transporters represents a sophisticated research question with implications for bacterial physiology:

  • Integrated Transport Network Analysis:

    • Map all Na+, H+, and K+ transporters in B. subtilis

    • Generate multiple mutants with combinations of transporter deletions

    • Perform epistasis analysis to identify functional relationships

    • Develop mathematical models of ion flux through multiple transporters

  • Regulation Coordination Studies:

    • Analyze transcriptional responses of transport systems under stress conditions

    • Identify shared regulatory elements controlling multiple transporters

    • Investigate post-translational regulation mechanisms

    • Track protein-protein interactions between different transport systems

  • Physiological Impact Assessment:

    • Measure intracellular ion concentrations in various transporter mutants

    • Correlate transporter activity with growth under different stress conditions

    • Examine impacts on membrane potential and energy metabolism

    • Investigate roles in specialized processes like sporulation and biofilm formation

  • Clinical and Applied Implications:

    • Assess the potential of transport systems as antimicrobial targets

    • Explore applications in developing stress-resistant production strains

    • Investigate contributions to virulence in pathogenic Bacillus species

    • Develop transport system modifications for biotechnological applications

Research has already demonstrated functional relationships between the mrp system and other transporters, such as tetA(L), where a double mutant was no more sensitive than the mrpA single mutant . This suggests complex functional relationships that may include redundancy, complementation, or coordinated activity. Further research into these interactions will provide insights into how bacteria maintain ion homeostasis under varying environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.