Recombinant Bacillus subtilis Nitrate reductase gamma chain (narI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
narI; BSU37250; Nitrate reductase gamma chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-223
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
narI
Target Protein Sequence
MSGQILWGIMPYIVLTIFIGGHIYRYQHDQFGWTAKSSELLEKKKLAAGSTLFHWGLLCV VGGHVMGILIPEGVYASLGISEHMYHKMAIGAGLPAGIAACTGLVILTYRRLFDKRIRKT SSPSDILTLLLLLFMMLSGVAATFLNIDSKGFDYRTTVGPWFREIVLFRPDASLMESVPL WFKFHIVIGYVVFILWPFTRLVHVFSLPLKYLTRSYVVYRKRS
Uniprot No.

Target Background

Function
The gamma chain is a membrane-embedded heme-iron unit resembling cytochrome b. It functions in electron transfer from quinones to the beta subunit.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the nitrate reductase system in Bacillus subtilis and how does narI fit into it?

Bacillus subtilis possesses two distinct nitrate reductase systems: the assimilatory system (encoded by nasBC) and the respiratory system (encoded by narGHI). The narI gene specifically encodes the gamma chain of the respiratory nitrate reductase. This respiratory nitrate reductase is responsible for nitrate respiration, allowing B. subtilis to use nitrate as an alternative electron acceptor under oxygen-limited conditions .

The respiratory nitrate reductase is a membrane-bound enzyme complex comprising three subunits:

  • NarG (α-subunit): Contains the molybdenum cofactor active site

  • NarH (β-subunit): Contains iron-sulfur clusters

  • NarI (γ-subunit): A transmembrane cytochrome b that anchors the complex to the membrane and transfers electrons to the catalytic subunits

How does narI differ from other components of the nitrate reduction pathway in B. subtilis?

While narI encodes a component of the respiratory nitrate reductase, B. subtilis also possesses the nas operon, which includes nasBC (assimilatory nitrate reductase) and nasDEF (nitrite reductase and cofactor formation). The key differences include:

  • Cellular location: NarI is membrane-bound, while NasBC is soluble and cytoplasmic

  • Function: NarI is primarily involved in energy generation during anaerobic respiration, while NasBC functions in nitrogen assimilation

  • Regulation: NarGHI expression is induced by oxygen limitation and regulated by FNR, while NasBC is controlled by nitrogen limitation and regulated by TnrA

What factors regulate narI expression in B. subtilis?

The expression of narGHI in B. subtilis is primarily regulated by:

  • Oxygen availability: Expression is highly induced under oxygen-limited conditions

  • FNR protein: An anaerobic regulatory protein that acts as a transcriptional activator

  • ResDE two-component system: Required for anaerobic induction of both nitrate and nitrite reductases

  • Nitrate/nitrite presence: Nitrite enhances anaerobic growth by serving as an electron sink

Research data indicates that the narGHI operon expression increases significantly when cells transition from aerobic to anaerobic conditions, with a corresponding increase in nitrate reductase activity .

How do the dual nitrate reduction systems interact in B. subtilis?

While B. subtilis has two distinct nitrate reductases (NarGHI and NasBC), interestingly, it possesses only a single nitrite reductase encoded by nasDE that functions in both assimilatory and respiratory pathways. This creates a regulatory intersection between the two systems.

Analysis of nasDEF expression shows it is driven both by:

  • The main nas operon promoter (activated by TnrA during nitrogen limitation)

  • An internal promoter located between nasC and nasD

Under anaerobic conditions, nasDEF expression is co-regulated with the respiratory nitrate reductase narGHI, suggesting coordination between the assimilatory and respiratory pathways .

What are the best methods for recombinant expression of B. subtilis narI protein?

Based on current research protocols, recombinant B. subtilis NarI protein can be successfully expressed with the following methodology:

  • Expression system:

    • Host: E. coli or yeast expression systems

    • Tagging: His-tag for purification purposes

    • Vector: Selection depends on desired yield and downstream applications

  • Purification protocol:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Buffer optimization: PBS buffer is commonly used for storage

    • Purity assessment: >80% by SDS-PAGE analysis

  • Quality control parameters:

    • Endotoxin levels: <1.0 EU per μg of protein (determined by LAL method)

    • Storage conditions: +4°C for short term; -20°C to -80°C for long term stability

What approaches can be used for genome editing to study narI function in B. subtilis?

Recent advances in B. subtilis genome editing provide efficient methods for narI functional studies:

  • Lambda Red-based system:

    • A lambda beta protein-mediated recombination system using single-stranded DNA (ssDNA) with short homology regions

    • Components: Temperature-sensitive plasmid pWY121 containing lambda cI857 P<sub>RM</sub>-P<sub>R</sub> promoter system

    • Process: Lambda beta protein promotes homologous recombination with ssDNA PCR products flanked by 70 nt homology extensions

  • In-frame deletion workflow:

    • Transform B. subtilis harboring pWY121 with PCR products containing lox sites

    • Select transformants based on bleomycin resistance

    • Incubate at 42°C to induce Cre recombinase expression

    • Verify marker deletion by bleomycin sensitivity testing

    • Colony-purify and confirm plasmid loss

This method has shown efficiency of >80% for marker deletion and allows for multiple gene manipulations in the same genetic background with no marker remaining .

How can I design experiments to distinguish between respiratory and assimilatory nitrate reduction in B. subtilis?

To differentiate between the two nitrate reduction pathways, consider this experimental design approach:

  • Strain construction:

    • Wild-type strain

    • ΔnarG or ΔnarI mutant (respiratory deficient)

    • ΔnasB or ΔnasC mutant (assimilatory deficient)

    • ΔnasD or ΔnasE mutant (affects both pathways)

  • Growth conditions:

    ConditionMediumOxygenNitrogen SourceExpected Growth
    Aerobic + N-richLB+Complex NAll strains grow
    Aerobic + N-limitedMinimal medium + nitrate+Nitrate onlyWT and nar mutants grow
    Anaerobic + N-richLB + nitrate-Complex N + nitrateWT and nas mutants grow
    Anaerobic + N-limitedMinimal medium + nitrate-Nitrate onlyOnly WT grows well
  • Activity assays:

    • Measure nitrate consumption rates

    • Quantify nitrite accumulation

    • Assess NADH-dependent nitrite reductase activity in cell extracts

    • Perform subcellular fractionation to distinguish membrane-bound vs. soluble activities

  • Expression analysis:

    • RT-PCR or RNA-Seq to measure narGHI and nasBC transcript levels

    • Western blot analysis with specific antibodies against NarI and NasC

    • Reporter gene fusions to monitor promoter activities under different conditions

What approaches are recommended for investigating the role of narI in biofilm formation or other complex phenotypes?

For studying narI's potential role in complex phenotypes:

  • Comparative phenotypic analysis:

    • Compare wild-type and ΔnarI strains for:

      • Biofilm formation using crystal violet staining

      • Cell morphology by microscopy

      • Growth kinetics under various conditions

      • Motility assays (swimming, swarming)

      • Sporulation efficiency

  • Transcriptomic analysis:

    • RNA-Seq experimental design considerations:

      • Compare aerobic vs. anaerobic conditions

      • Include appropriate biological replicates (minimum 3)

      • Carefully control for growth phase effects

      • Consider time-course experiments to capture dynamic changes

  • Genetic interaction mapping:

    • Construct double mutants with genes involved in:

      • Other respiratory pathways

      • Biofilm formation

      • Stress response

      • Central metabolism

  • In situ visualization:

    • Fluorescent protein fusions to track NarI localization

    • Metabolic staining to visualize respiratory activity in biofilms

    • Oxygen gradient measurements in structured communities

How can I address inconsistent results in nitrate reductase activity assays?

When encountering variability in nitrate reductase activity measurements:

  • Cell preparation variables to control:

    • Harvest cells at consistent growth phase (late exponential recommended)

    • Standardize washing procedures (10 mM Tris-HCl, pH 7.4, 10 mM MgCl₂)

    • Use proper cell disruption method (French press recommended)

    • Perform initial centrifugation at 5,000 × g (5 min, 4°C) to remove debris

    • For subcellular fractionation, centrifuge at 100,000 × g

  • Assay conditions optimization:

    • Temperature and pH must be strictly controlled

    • Ensure anaerobic conditions are maintained throughout the assay

    • Include appropriate electron donors (NADH for NasDE)

    • Control substrate concentrations

    • Include proper enzyme controls

  • Statistical analysis:

    • Use ANOVA for comparisons between multiple treatments

    • For non-normal distributions with small sample sizes, consider nonparametric methods

    • Report both mean values and measures of variation (standard deviation)

    • For binary data, include numerator and denominator, not just percentage 11

What criteria should I use to evaluate the quality of my research on recombinant B. subtilis narI?

Apply the FINER criteria (Feasible, Interesting, Novel, Ethical, and Relevant) to assess research quality:

  • Feasibility assessment:

    • Resources availability (funding, time, expertise)

    • Technical capabilities for expression and purification

    • Access to necessary analytical tools

    • Availability of appropriate bacterial strains

  • Novelty evaluation:

    • Conduct thorough literature review to identify knowledge gaps

    • Determine if your approach:
      a) Improves upon limitations in previous studies
      b) Investigates unknown areas
      c) Replicates existing work for validation

  • Experimental design rigor:

    • Clear definition of variables and controls

    • Appropriate sample sizes with justification

    • Randomization and blinding where applicable

    • Inclusion of statistical power calculations

    • Proper replication strategy (biological vs. technical replicates)

  • Data reporting standards:

    • Follow field-specific guidelines for experimental details

    • Include all essential experimental procedures in main text, not just supplements

    • Provide complete information on:
      a) Reagents (enzymes, antibodies, kits, commercial instruments)
      b) Biological resources (strains, plasmids, vectors)
      c) Statistical analyses (equations, replicates)
      d) Novel programs or algorithms used

What are promising avenues for advanced narI research in B. subtilis?

Several emerging areas offer opportunities for innovative research on B. subtilis narI:

  • Structure-function studies:

    • High-resolution structural analysis of the NarGHI complex

    • Site-directed mutagenesis to identify critical residues

    • Investigation of protein-protein interactions within the complex

    • Comparative analysis with nitrate reductases from other organisms

  • Systems biology approaches:

    • Integration of transcriptomic, proteomic, and metabolomic data

    • Computational modeling of electron transport chains

    • Network analysis of respiratory pathways

    • Global regulatory network mapping under different oxygen conditions

  • Ecological and evolutionary perspectives:

    • Comparative genomics across diverse B. subtilis strains

    • Adaptation to different environmental niches

    • Investigation of horizontal gene transfer events

    • Analysis of selective pressures on respiratory genes

  • Biotechnological applications:

    • Engineered strains with enhanced nitrate reduction capabilities

    • Bioremediation of nitrate-contaminated environments

    • Development of biosensors for environmental monitoring

    • Protein engineering for improved catalytic efficiency

How can I design experiments to investigate potential interactions between narI and other respiratory systems?

To explore the interplay between the nitrate respiratory system and other electron transport pathways:

  • Experimental design approach:

    • Construct single and combinatorial mutants in different respiratory pathways

    • Perform growth analysis under various electron acceptor conditions

    • Measure redox balance indicators (NAD⁺/NADH ratio, ATP levels)

    • Analyze electron flow using specific inhibitors

  • Respiratory chain interaction study matrix:

    Electron AcceptorWild-typeΔnarIΔresDEΔfnr
    O₂++++++++++
    NO₃⁻+++-+-
    NO₂⁻++++++
    Fumarate++++++++
    No acceptor----
  • Transcriptional regulation analysis:

    • ChIP-seq to identify regulatory protein binding sites

    • Promoter fusion reporter assays under different conditions

    • Global transcription analysis under combination treatments

    • Protein-protein interaction studies between regulatory components

  • Metabolic flux analysis:

    • Isotope labeling experiments to track electron flow

    • Measurement of key metabolic intermediates

    • Quantification of terminal electron acceptor utilization rates

    • Modeling of electron distribution under different conditions

By systematically investigating these aspects, researchers can gain comprehensive insights into the role of narI in the broader context of B. subtilis respiratory physiology and adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.