Recombinant Bacillus subtilis Oligopeptide transport system permease protein oppB (oppB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bacillus subtilis Oligopeptide Transport System Permease Protein OppB

The recombinant Bacillus subtilis oligopeptide transport system permease protein OppB (OppB) refers to a bioengineered version of the native OppB protein, a critical component of the oligopeptide permease (Opp) system. This ATP-binding cassette (ABC) transporter facilitates the import of small peptides (typically 3–5 residues) into bacterial cells, playing dual roles in nutrient acquisition and intracellular signaling pathways .

Mechanism of Action

  1. Substrate Recognition: OppA binds peptides via charge interactions with termini and backbone hydrogen bonds, allowing broad specificity .

  2. Transmembrane Transport: OppB and OppC form a pore that translocates peptides into the cytoplasm.

  3. Energy Coupling: ATP hydrolysis by OppD and OppF drives conformational changes in the transporter .

Role in Bacterial Development and Signaling

  • Sporulation and Competence: The Opp system imports signaling peptides (e.g., Phr peptides) that regulate sporulation and genetic competence in B. subtilis .

  • Osmoprotection: Opp transports proline-containing peptides, which are hydrolyzed to generate the osmolyte l-proline, aiding survival under high osmolarity .

Functional Specificity and Mutations

  • Substrate Specificity: Mutations in OppA alter peptide transport specificity, but OppB’s role in pore formation is conserved. For example, oppA-null mutants show complete transport defects, while oppF mutations cause partial defects .

  • Nanoparticle Interactions: External stressors like ZnO nanoparticles upregulate Opp expression, enhancing competence in biofilms, while TiO₂ suppresses it .

Comparative Analysis with Other Transporters

TransporterSubstrate PreferencePrimary Function
OppTri- to penta-peptidesNutrient uptake, quorum sensing
DppDipeptides, murein peptidesCell wall peptide recycling
AppOligopeptides (in functional strains)Redundant with Opp in signaling

Production Parameters

The recombinant OppB is produced via heterologous expression in E. coli, with a His-tag for affinity purification . This system enables structural and functional studies of OppB’s transmembrane domain.

Potential Applications

  1. Structural Biology: Crystallographic studies to elucidate pore architecture and substrate interactions.

  2. Drug Delivery: Exploiting OppB’s pore for targeted peptide delivery in biofilms or spores.

  3. Antibiotic Resistance: Understanding how Opp mutations confer resistance to toxic peptides (e.g., bialaphos) .

Challenges and Future Directions

While recombinant OppB provides a tool for studying peptide transport, gaps remain:

  • Structural Data: No high-resolution structures of OppB alone or in the Opp complex are available.

  • Functional Redundancy: Overlap with App and Dpp systems complicates dissection of OppB’s unique roles .

Future research could integrate cryo-EM or single-molecule studies to resolve OppB’s dynamics and specificity determinants.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing the order, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
oppB; spo0KB; BSU11440; Oligopeptide transport system permease protein OppB; Stage 0 sporulation protein KB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
oppB
Target Protein Sequence
MLKYIGRRLVYMIITLFVIVTVTFFLMQAAPGGPFSGEKKLPPEIEANLNAHYGLDKPLF VQYVSYLKSVAMWDFGPSFKYKGQSVNDLISSGFPVSFTLGAEAILLALALGVLFGVIAA LYHNKWQDYTVAILTIFGISVPSFIMAAVLQYVFSMKLGLFPVAGWDSWAYTFLPSIALA SMPMAFIARLSRSSMIEVLNSDYIRTAKAKGLSRPAVTVRHAIRNALLPVVTYMGPMAAQ VLTGSFIIETIFGIPGLGAHFVNSITNRDYTVIMGVTVFFSVILLLCVLIVDVLYGIIDP RIKLSKAKKGA
Uniprot No.

Target Background

Function
This protein is a component of the binding-protein-dependent transport system for oligopeptides. It is believed to be responsible for the translocation of the substrate across the membrane. Additionally, it is required for sporulation and competence.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What is the Bacillus subtilis oligopeptide permease system and what role does OppB play?

The oligopeptide permease (Opp) system in Bacillus subtilis is a member of the ATP binding cassette (ABC) transporter family responsible for importing peptides of 3-5 amino acids. The system consists of five proteins: OppA, OppB, OppC, OppD, and OppF. OppB specifically functions as one of the two membrane-spanning proteins (alongside OppC) that form the transmembrane pore through which oligopeptides are imported into the cell. This transport system is essential not only for nutrient acquisition but also for regulatory processes including sporulation and genetic competence development .

To study OppB function, researchers typically employ genetic approaches including targeted gene deletions, site-directed mutagenesis, and protein tagging techniques. Complementation studies, where wild-type oppB is reintroduced into knockout strains, can confirm phenotype specificity. Biochemical approaches such as membrane protein isolation and reconstitution can further characterize the transport mechanism.

What are the phenotypic consequences of oppB deletion in B. subtilis?

Deletion of oppB results in complete blockage of oligopeptide uptake . This leads to multiple phenotypic consequences:

  • Resistance to toxic oligopeptides (such as bialaphos)

  • Impaired sporulation (mutants appear as translucent colonies on sporulation media)

  • Reduced competence for DNA transformation

  • Altered developmental timing and gene expression patterns

These phenotypes occur because the Opp system in B. subtilis serves both nutritional and regulatory functions. For nutritional functions, it enables the utilization of peptides as nutrient sources. For regulatory functions, it facilitates the import of specific signaling peptides that influence sporulation and competence pathways .

What are the most effective methods for recombinant expression of B. subtilis OppB?

Recombinant expression of B. subtilis OppB presents challenges due to its hydrophobic nature as a membrane protein. Several methodologies have been developed:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coliHigh yield, well-established protocolsPotential toxicity, inclusion body formationRequires specialized strains (C41/C43), mild induction
B. subtilisNative environment, proper foldingLower yields than E. coliCan use spore display systems
Cell-free systemsAvoids toxicity issuesExpensive, lower yieldRequires supplementation with lipids/detergents
Spore displayCombined expression and deliveryLimited to applications where spores are suitableEnables oral vaccination approaches

For B. subtilis spore display systems, the methodology involves fusing OppB to spore coat proteins. This approach has been successfully employed for other membrane proteins and offers advantages for certain applications, particularly where the bacteria can serve simultaneously as an expression system and delivery vehicle .

How can researchers optimize the purification of functional recombinant OppB?

Purification of membrane proteins like OppB requires specialized approaches:

  • Membrane extraction: Use mild detergents (DDM, LDAO, or digitonin) for solubilization while maintaining protein integrity. Start with a detergent screen to identify optimal conditions.

  • Affinity chromatography:

    • Add affinity tags (His6, FLAG, Strep) to either N- or C-terminus

    • Test multiple tag positions to identify optimal placement that doesn't interfere with function

    • Include protease inhibitor cocktails to prevent degradation

  • Size exclusion chromatography: Critical for separating properly folded protein from aggregates

  • Functional verification:

    • Transport assays using reconstituted proteoliposomes

    • Binding assays with labeled peptides

    • ATPase activity measurements in conjunction with OppD/OppF

  • Stability optimization:

    • Screen various lipid/detergent combinations

    • Test stabilizing additives (glycerol, specific lipids)

    • Consider nanodiscs or other membrane mimetics for long-term stability

The purification protocol must be validated by confirming that the recombinant protein retains its native function, typically through complementation of oppB-deficient strains or in vitro transport assays.

What genetic tools are available for studying oppB function in B. subtilis?

Several genetic approaches have been developed to study oppB function:

  • Knockout systems:

    • Clean deletion mutants available from Bacillus Genetic Stock Center (BGSC)

    • CRISPR-Cas9 systems for precise genome editing

    • Integration of antibiotic resistance cassettes for selection

  • Fluorescent tagging strategies:

    • C-terminal GFP fusions (similar to the RpsB-GFP approach described for ribosomal proteins)

    • Construction methods involve overlap PCR and double crossover integration

    • Verification by PCR and fluorescence microscopy

  • Expression control systems:

    • Inducible promoters (IPTG, xylose-inducible)

    • Native promoter replacement

    • Antisense RNA systems for conditional knockdowns

  • Mutation analysis:

    • Site-directed mutagenesis to identify functional residues

    • Random mutagenesis followed by selection (e.g., bialaphos resistance screening)

    • Complementation testing with mutant variants

These approaches can be combined with phenotypic assays for peptide transport, sporulation efficiency, and competence development to comprehensively characterize OppB function.

How can OppB be engineered for spore display systems in vaccine development?

B. subtilis spores can be engineered to display heterologous proteins like OppB on their surface, creating potential vaccine delivery vehicles. This approach has been successfully implemented for TonB-dependent receptors (TBDRs) from Acinetobacter baumannii, suggesting similar strategies could work for OppB :

Methodology for OppB spore display:

  • Vector construction:

    • Create fusion proteins between OppB and spore coat proteins (CotB, CotC, or CotG)

    • Optimize linker sequences to ensure proper folding and accessibility

    • Include promoters that activate during sporulation

  • Expression verification:

    • Immunoblotting with anti-OppB antibodies using spore coat protein extracts

    • Immunofluorescence microscopy to confirm surface localization

    • Flow cytometry quantification

  • Functional assessment:

    • Verify OppB maintains native conformation using conformation-specific antibodies

    • Test binding of natural substrates or antibodies

    • Assess stability during gastrointestinal transit if targeting oral delivery

  • Immunization protocol:

    • Oral administration (typically 1×10^9 recombinant spores per dose)

    • Multiple-dose regimen (e.g., days 0-2, 16-18, 32-34)

    • Collection of serum and intestinal samples to evaluate immune responses

This approach leverages the inherent advantages of B. subtilis spores, including their GRAS (Generally Recognized As Safe) status, exceptional resistance, and natural adjuvant properties .

How do you resolve contradictory findings when analyzing OppB function across different experimental systems?

When facing contradictory results in OppB research, a systematic approach to reconciling discrepancies is essential:

  • Methodological assessment:

    • Compare experimental conditions (growth media, temperature, strain backgrounds)

    • Evaluate protein expression levels and localization

    • Assess potential polar effects in genetic constructs

    • Consider membrane composition differences between systems

  • Triangulation approach:

    • Employ multiple, complementary methods to study the same question

    • Combine in vivo and in vitro approaches

    • Use both gain-of-function and loss-of-function studies

  • Sequence and strain verification:

    • Confirm the genetic background of strains used

    • Verify absence of suppressor mutations

    • Consider natural variation in oppB between B. subtilis strains

  • Advanced analysis techniques:

    • Time-lapse microfluidics microscopy to track dynamic processes

    • Single-cell analysis to identify heterogeneous responses

    • Multi-omics approaches to capture system-wide effects

    • Super-resolution microscopy (e.g., Lattice SIM) for precise localization

When publishing results, contradictory findings should be explicitly addressed with possible explanations for discrepancies and suggestions for experimental approaches that might resolve them .

What is the relationship between OppB-mediated peptide transport and sporulation regulation?

The connection between OppB function and sporulation is complex and multifaceted:

  • Signaling peptide transport:

    • The Opp system imports specific signaling peptides (Phr peptides) that regulate sporulation

    • These peptides antagonize Rap family regulatory proteins

    • Competence and sporulation-stimulating factor (CSF) is a key pentapeptide transported via this system

  • Experimental approaches to study this relationship:

    • Genetic separation of transport functions from regulatory functions through specific mutations

    • Peptide binding assays with purified components

    • Epistasis analysis with regulatory pathway components

    • Single-cell microscopy to track temporal dynamics of sporulation in wild-type vs. oppB mutants

  • Specialized techniques:

    • Fluorescent reporters for sporulation gene expression

    • Quantitative sporulation efficiency assays

    • Phosphoproteomics to track activation of sporulation phosphorelay

    • Structural analysis of OppB-peptide interactions

  • Data integration:

    • Mathematical modeling of the sporulation decision circuit

    • Network analysis of oppB interactions with other sporulation genes

    • Temporal correlation between peptide transport and sporulation events

Understanding this relationship requires distinguishing between direct effects of peptide transport and indirect effects from altered metabolism or stress responses in oppB mutants.

What are the common pitfalls in recombinant OppB expression and how can they be addressed?

Recombinant expression of membrane proteins like OppB presents numerous challenges:

ChallengePossible CausesSolutions
Low expressionToxicity, codon bias, mRNA stabilityUse tight expression control, codon optimization, low temperature induction
Protein misfoldingImproper membrane integration, aggregationTest various membrane-mimetic environments, fusion partners, periplasmic targeting
Functionality lossTag interference, missing cofactorsVary tag position, supplement with native lipids, co-express with OppC
DegradationProtease sensitivity, instabilityInclude protease inhibitors, optimize buffer conditions, reduce induction time
Purification difficultiesDetergent incompatibility, aggregationScreen detergent panel, optimize solubilization conditions, use gentle extraction

For specific expression in B. subtilis spore display systems, additional considerations include ensuring proper fusion to spore coat proteins and optimizing sporulation conditions to maximize yield .

How can researchers distinguish between direct OppB-mediated effects and indirect consequences of disrupting peptide transport?

This represents a significant challenge in functional studies. Methodological approaches include:

  • Genetic strategies:

    • Create partial loss-of-function mutants (as described in search result )

    • Engineer OppB variants with altered rather than abolished function

    • Design peptide specificity mutants that transport some peptides but not others

    • Use compensatory mutations that restore specific functions

  • Biochemical approaches:

    • In vitro reconstitution of the complete Opp transport system

    • Direct measurement of peptide transport with labeled substrates

    • Activity assays for downstream regulatory proteins

  • Systems biology:

    • Temporal analysis correlating transport activity with phenotypic changes

    • Multi-omics profiling to distinguish primary from secondary effects

    • Network perturbation analysis to identify direct OppB-dependent processes

  • Rescue experiments:

    • Bypass studies where transported peptides are artificially introduced

    • Expression of downstream components under alternative regulation

    • Complementation with heterologous transporters having similar but distinct specificity

This combined approach helps establish causality and distinguish direct effects of OppB from secondary consequences of altered cellular physiology.

What strategies exist for analyzing OppB membrane topology and structure-function relationships?

Investigating the membrane topology and structure-function relationships of OppB requires specialized approaches:

  • Experimental topology mapping:

    • Cysteine scanning mutagenesis with membrane-impermeable labeling reagents

    • Protease accessibility assays with epitope-tagged variants

    • FRET-based approaches to determine proximity relationships

    • Substituted cysteine accessibility method (SCAM)

  • Computational prediction:

    • Transmembrane domain prediction algorithms (TMHMM, Phobius)

    • Homology modeling based on related transporters

    • Molecular dynamics simulations in membrane environment

    • Evolutionary coupling analysis to identify co-evolving residues

  • Functional analysis of structure:

    • Alanine-scanning mutagenesis of predicted functional domains

    • Creation of chimeric proteins with related transporters

    • Identification of substrate specificity determinants through directed evolution

    • Cross-linking studies to capture transport intermediates

  • Advanced structural methods:

    • Site-specific incorporation of photoactivatable amino acids

    • Hydrogen-deuterium exchange mass spectrometry

    • Electron paramagnetic resonance spectroscopy

    • Single-particle cryo-EM of the assembled Opp complex

These approaches provide complementary information that, when integrated, yields insights into how OppB structure enables peptide transport function.

How can synthetic biology approaches be used to engineer OppB for novel substrate specificities?

Engineering OppB for new substrate specificities represents an exciting frontier with several methodological approaches:

  • Directed evolution strategies:

    • Create random mutagenesis libraries targeting predicted substrate-binding regions

    • Develop selection systems based on transport of modified peptides

    • Apply compartmentalized directed evolution techniques

    • Implement continuous evolution systems with iterative selection

  • Rational design approaches:

    • Structure-guided mutagenesis based on homology models

    • Computational prediction of substrate-binding pocket modifications

    • Domain swapping with related transporters having different specificities

    • Introduction of non-canonical amino acids at key positions

  • Testing and validation:

    • Transport assays with fluorescently labeled peptide variants

    • Growth-based selection on media containing modified peptides

    • In vivo biosensor systems that report on successful transport

    • Biophysical characterization of binding affinities

  • Applications of engineered OppB variants:

    • Development of biosensors for specific peptide detection

    • Creation of strains with altered regulatory responses

    • Engineered transport of therapeutic peptides

    • Novel delivery systems based on modified substrate specificity

Understanding the natural substrate profiles of OppB mutants, such as those described in search result , provides valuable insights for these engineering approaches.

What role might OppB play in engineering B. subtilis as a probiotic or therapeutic delivery system?

The potential for using OppB-engineered B. subtilis as a probiotic or therapeutic delivery platform is substantial:

  • Probiotic applications:

    • Engineering OppB to import specific beneficial peptides

    • Modifying substrate specificity to enhance nutrient utilization

    • Creating strains with enhanced stress resistance through modified peptide signaling

    • Developing biosensor strains that respond to gut environment signals

  • Therapeutic delivery applications:

    • Spore display systems incorporating OppB for vaccine development

    • Engineering B. subtilis to produce and export therapeutic peptides

    • Creating strains with controlled germination based on OppB signaling

    • Developing precision probiotics that respond to specific gut peptides

  • Experimental approaches:

    • In vitro gastrointestinal tract models to test stability and function

    • Animal studies to evaluate colonization and persistence

    • Immune response assessment following oral administration

    • Safety evaluation through comprehensive phenotyping

  • Advantages of the B. subtilis platform:

    • GRAS status facilitating regulatory approval

    • Natural adjuvant properties enhancing immune responses

    • Ability to form resistant spores enabling oral delivery

    • Genetic tractability allowing precise engineering

This research direction leverages the dual advantages of B. subtilis as both an expression system and delivery vehicle, with OppB engineering providing specificity to the system's function.

How do environmental and physiological conditions affect OppB expression and function?

Understanding the environmental regulation of OppB is critical for both basic research and applications:

  • Regulatory mechanisms:

    • Transcriptional control under nutrient limitation

    • Post-translational modifications affecting activity

    • Integration with global regulatory networks

    • Interactions with other transport systems

  • Experimental approaches:

    • Reporter gene fusions to monitor expression

    • Quantitative proteomics across conditions

    • Transporter activity assays under varying environments

    • Single-cell analysis to identify heterogeneous responses

  • Key environmental factors to consider:

    • Nutrient availability (particularly amino acids and peptides)

    • Growth phase and cell density

    • Stress conditions (temperature, pH, osmotic pressure)

    • Presence of competing microorganisms

  • Methodological considerations:

    • Time-lapse microscopy to track expression dynamics

    • Microfluidic systems for precise environmental control

    • In situ analysis in natural environments

    • Mathematical modeling of regulatory networks

Understanding these regulatory mechanisms provides insights into the physiological role of OppB and informs strategies for its application in biotechnology and therapeutic contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.