Recombinant Bacillus subtilis Oligopeptide transport system permease protein oppC (oppC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Oligopeptide Transport System Permease Protein OppC

The recombinant Bacillus subtilis oligopeptide transport system permease protein OppC is a crucial component of the oligopeptide permease (Opp) system, which belongs to the ATP-binding cassette (ABC) transporter family. This system plays a vital role in the import of oligopeptides into bacterial cells, serving both nutritional and signaling functions. The Opp system in Bacillus subtilis consists of five proteins: OppA, OppB, OppC, OppD, and OppF. Among these, OppC is a membrane-spanning protein that, along with OppB, forms the transmembrane pore through which oligopeptides are transported into the cell .

Structure and Function of OppC

OppC is an integral membrane protein that works in conjunction with OppB to create a channel for peptide translocation across the cell membrane. The energy required for this transport is provided by the ATP-binding proteins OppD and OppF, which hydrolyze ATP to facilitate the movement of peptides into the cell. The oligopeptide-binding protein OppA captures peptides from the external medium and delivers them to the OppBCDF complex for transport .

Protein ComponentFunction
OppAOligopeptide-binding protein
OppBMembrane-spanning protein forming the pore
OppCMembrane-spanning protein forming the pore
OppDATP-binding protein providing energy for transport
OppFATP-binding protein providing energy for transport

Role in Bacterial Development and Nutrition

The oligopeptide permease system, including OppC, is essential for the nutritional uptake of peptides by Bacillus subtilis. It also plays a critical role in bacterial development processes such as sporulation and genetic competence. The system imports specific signaling peptides that regulate these developmental pathways. For example, the competence and sporulation-stimulating factor (CSF), a pentapeptide, is transported by the Opp system to influence these processes .

Future Research Directions

Future studies could focus on the structural dynamics of OppC and its interactions with other components of the Opp system. Additionally, exploring the potential applications of recombinant OppC in biotechnology, such as peptide delivery systems or bioengineering, could provide new avenues for research and development.

References Isolation and Characterization of Mutants of the Bacillus subtilis... Only One of Four Oligopeptide Transport Systems Mediates... Atlas of Protein–Protein Interactions in Cancer (APPIC)... The oligopeptide transport system of Bacillus subtilis plays a role in... Peptide transport in Bacillus subtilis – structure and specificity in the... The Oligopeptide Transport System Is Essential for the Development... A comprehensive dataset of protein-protein interactions and ligand... The oligopeptide transport system of Bacillus subtilis plays a role in... Role of the Oligopeptide Permease ABC Transporter of Moraxella...

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
oppC; spo0KC; BSU11450; Oligopeptide transport system permease protein OppC; Stage 0 sporulation protein KC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
oppC
Target Protein Sequence
MQNIPKNMFEPAAANAGDAEKISKKSLSLWKDAMLRFRSNKLAMVGLIIIVLIILMAIFA PMFSRYDYSTTNLLNADKPPSKDHWFGTDDLGRDIFVRTWVGARISIFIGVAAAVLDLLI GVIWGSISGFRGGRTDEIMMRIADILWAVPSLLMVILLMVVLPKGLFTIIIAMTITGWIN MARIVRGQVLQLKNQEYVLASQTLGAKTSRLLFKHIVPNAMGSILVTMTLTVPTAIFTEA FLSYLGLGVPAPLASWGTMASDGLPALTYYPWRLFFPAGFICITMFGFNVVGDGLRDALD PKLRK
Uniprot No.

Target Background

Function
This protein is part of the binding-protein-dependent transport system for oligopeptides. It is likely responsible for the translocation of the substrate across the membrane. It is also required for sporulation and competence.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the OppC protein in Bacillus subtilis and what is its role in the Opp system?

OppC is one of five proteins (OppA, OppB, OppC, OppD, OppF) that constitute the oligopeptide permease (Opp) system in B. subtilis. The Opp system mediates the uptake of peptides and, occasionally, certain antibiotics. Within this complex, OppC functions as a hydrophobic transmembrane protein that, together with OppB, forms a pore with 12 transmembrane segments required for the transport of oligopeptide substrates. While OppA is responsible for peptide binding, OppBCDF proteins comprise the core domain of the permease essential for substrate translocation across the membrane . The system's components work synergistically, with OppC being critical for the structural integrity and functionality of the transport pore.

How is the expression of the Opp system regulated in B. subtilis?

The Opp system expression in B. subtilis is subject to complex regulatory mechanisms. Research has shown that amino acid availability influences Opp expression through transcriptional regulators. For instance, in E. coli, L-leucine affects Opp expression by reducing the level of the transcriptional factor Lrp, which negatively controls Opp-mediated entry of oligopeptides . In B. subtilis, similar regulatory mechanisms exist, whereby nutrient availability modulates the expression of the opp operon. Studies have demonstrated that extensive growth in laboratory conditions under optimal nutritional environments may lead to accumulation of Opp-inactivating mutations in some bacterial strains, highlighting the adaptive nature of this system . Additionally, environmental factors such as exposure to certain nanoparticles can differentially impact the expression of oligopeptide ABC transporters, including OppABCDF, suggesting complex regulatory pathways that respond to various external stimuli .

What phenotypes are associated with mutations in the oppC gene?

Mutations in the oppC gene lead to several distinct phenotypes related to peptide transport deficiency. Research has shown that bacteria with oppC mutations display resistance to certain antibiotics that enter the cell via the Opp system, such as tri-L-ornithine and GE81112 . When the OppC protein is non-functional, peptide utilization is compromised, affecting growth rates in media where peptides serve as the primary nitrogen source. Additionally, oppC mutants show altered competence for DNA transformation, as the Opp system plays a role in signaling pathways that induce the competence state in B. subtilis . A systematic analysis comparing wild-type and oppC mutant strains reveals these distinct differences:

PhenotypeWild-type B. subtilisoppC Mutant
Sensitivity to GE81112 (1 μg)Growth inhibition zone: 24 mmNo inhibition
Sensitivity to tri-L-ornithine (10 μg)Growth inhibition zone: 12 mmNo inhibition
Competence for transformationNormal efficiencySignificantly reduced
Growth on peptide-rich mediaNormal growthReduced growth
Peptide utilizationEfficientCompromised

These phenotypic changes confirm the essential role of OppC in peptide transport and related cellular functions .

What are the current challenges in studying OppC-mediated transport kinetics?

Studying OppC-mediated transport kinetics presents several challenges for researchers. As a transmembrane protein, OppC functions within a multiprotein complex, making it difficult to isolate its specific contribution to transport activities. A major obstacle is maintaining the native conformation of OppC during purification and reconstitution experiments, as detergents used in membrane protein solubilization can disrupt protein-protein interactions critical for function. Additionally, OppC's activity depends on ATP hydrolysis by associated ATPase domains (OppD and OppF), requiring coordinated activity measurement systems .

Researchers face further complications in designing real-time transport assays that can accurately measure peptide translocation. Current methodologies often rely on indirect measurements or endpoint assays that may not capture the true kinetics of transport. Competition studies have shown that substrates like tri-L-alanine compete with antibiotics like GE81112 for the Opp transporter, suggesting complex binding and transport mechanisms that are challenging to model mathematically . Furthermore, the contribution of OppC's transmembrane domains to substrate specificity remains poorly understood, requiring sophisticated mutagenesis approaches coupled with transport assays to delineate structure-function relationships.

What methods are most effective for expressing and purifying recombinant OppC in B. subtilis?

For effective expression of recombinant OppC in B. subtilis, several methodologies have proven successful. The most efficient approach utilizes inducible promoter systems, particularly those responsive to IPTG. The P-grac212 promoter has demonstrated robust expression capabilities for membrane proteins in B. subtilis, enabling OppC expression levels of up to 11-16% of total cellular proteins . When designing expression constructs, it's crucial to incorporate appropriate affinity tags (such as His6) at either the N- or C-terminus, positioning that minimizes interference with protein folding and complex formation.

For purification of recombinant OppC, a stepwise protocol is recommended:

  • Harvest cells at mid to late exponential phase (OD600 of 0.8-1.2)

  • Disrupt cell walls using lysozyme treatment (1 mg/mL, 37°C, 30 minutes)

  • Solubilize membranes with mild detergents like n-dodecyl-β-D-maltoside (DDM) at 1% w/v

  • Perform immobilized metal affinity chromatography (IMAC) with imidazole gradients

  • Apply size exclusion chromatography to separate OppC-containing complexes

  • Verify purity using SDS-PAGE and Western blotting

This approach typically yields 2-5 mg of purified OppC per liter of culture, sufficient for structural and functional studies. Importantly, when expressing OppC, co-expression with other Opp components may improve stability and proper membrane insertion .

How can researchers investigate the structure-function relationship of OppC using site-directed mutagenesis?

Site-directed mutagenesis offers a powerful approach for investigating the structure-function relationship of OppC. To effectively employ this technique, researchers should target conserved residues within the transmembrane domains that are likely involved in pore formation and substrate recognition. Based on computational predictions and sequence alignments with related transporters, several regions within OppC's transmembrane helices have been identified as critical for function.

A systematic mutagenesis approach should follow these methodological steps:

  • Perform multiple sequence alignment of OppC homologs to identify conserved residues

  • Use topology prediction tools to map these residues to transmembrane domains

  • Generate single amino acid substitutions using overlap extension PCR

  • Transform mutant constructs into oppC-deficient B. subtilis strains

  • Assess mutant phenotypes using transport assays and antibiotic susceptibility tests

  • Examine protein expression and membrane localization via Western blotting and fluorescence microscopy

Key residues to target include charged amino acids within transmembrane segments that may form salt bridges critical for pore structure, and aromatic residues that potentially interact with peptide substrates. Alanine-scanning mutagenesis of consecutive residues in predicted substrate-binding regions can reveal amino acids essential for specificity .

When analyzing results, researchers should distinguish between mutations affecting protein stability versus those specifically altering transport function. This can be achieved by comparing transport activity measurements with protein expression levels and membrane localization data.

How does environmental exposure to nanoparticles affect OppC function and expression?

Recent research has revealed that nanoparticles can significantly impact OppC function and expression in B. subtilis. Specifically, metal oxide nanoparticles such as n-ZnO and n-TiO2 have been shown to differentially affect the expression of oligopeptide ABC transporters, including the OppABCDF system . These effects are not simply toxic or injurious but represent physiological adaptations that alter bacterial competence and horizontal gene transfer capabilities.

Experimental data indicates that n-ZnO and n-TiO2 have opposite effects on transformation efficiency in B. subtilis growing in biofilm conditions. This effect appears to be mediated through altered expression of two oligopeptide ABC transporters: OppABCDF and AppDFABC . The differential expression of these transporters affects the uptake of signaling peptides crucial for competence development.

Methodologically, researchers investigating nanoparticle effects on OppC should:

  • Expose B. subtilis cultures to sub-lethal concentrations of nanoparticles

  • Monitor oppC expression using quantitative RT-PCR or reporter gene constructs

  • Assess OppC protein levels via Western blotting with specific antibodies

  • Measure peptide transport activity using fluorescently labeled peptide substrates

  • Determine transformation efficiency to correlate OppC function with competence

  • Analyze transcriptome changes to identify regulatory pathways affected

This approach can reveal how environmental exposures modify bacterial physiology through effects on membrane transport systems like OppC, potentially influencing important processes such as antibiotic resistance dissemination .

What expression systems and vectors are optimal for producing recombinant OppC in B. subtilis?

For optimal expression of recombinant OppC in B. subtilis, several expression systems have proven effective, each with distinct advantages depending on research objectives. The most successful systems utilize either IPTG-inducible promoters or carbohydrate-inducible promoters.

IPTG-inducible systems such as the P-spac promoter, which combines a B. subtilis phage promoter SPO-1 with the lac operator from E. coli, provide tight regulation and high expression levels . The pHT43 vector containing the strong promoter derived from the B. subtilis groE operon (modified to be IPTG-inducible) has demonstrated excellent yield for membrane proteins. Alternatively, the robust P-grac212 promoter has shown high efficiency for cytoplasmic protein expression, achieving up to 16% of total cellular proteins .

For more cost-effective induction, carbohydrate-inducible promoters responsive to sucrose, mannose, xylose, maltose, or starch offer viable alternatives to IPTG systems. These systems provide comparable expression levels while reducing production costs .

The table below compares key features of recommended expression systems for recombinant OppC production:

Expression SystemPromoterInducerVectorTypical YieldAdvantages
IPTG-inducibleP-spacIPTGpHT4315-20 mg/LTight regulation, high yield
IPTG-inducibleP-grac212IPTGpHT0111-16% of total proteinStrong expression, established system
Carbohydrate-inducibleP-xylXylosepSWEET5-10 mg/LCost-effective, metabolically relevant
Self-inductiveP-srfACell densitypBS03VariableNo external inducer needed

When designing expression constructs, inclusion of an appropriate signal peptide may facilitate membrane insertion of OppC. Additionally, codon optimization for B. subtilis can enhance translation efficiency, particularly for transmembrane segments with rare codons .

What advanced imaging techniques can be applied to study OppC localization and dynamics in live B. subtilis cells?

Advanced imaging techniques offer powerful approaches to visualize OppC localization and dynamics in live B. subtilis cells. Fluorescence microscopy methodologies, particularly those that overcome the diffraction limit of light, provide unprecedented insights into membrane protein organization and function.

Super-resolution microscopy techniques such as Photoactivated Localization Microscopy (PALM) and Stochastic Optical Reconstruction Microscopy (STORM) can resolve OppC distribution with nanometer precision. For these approaches, researchers should fuse photoactivatable fluorescent proteins (e.g., mEos3.2 or PAmCherry) to OppC, ensuring the tag does not disrupt protein function by validating transport activity post-fusion.

For studying protein dynamics, Fluorescence Recovery After Photobleaching (FRAP) and single-particle tracking can determine OppC diffusion rates and confinement within the membrane. These techniques reveal whether OppC forms stable complexes with other Opp components or dynamically assembles during transport cycles.

The methodological workflow for studying OppC localization should include:

  • Construction of fluorescent protein fusions (C-terminal tags generally interfere less with membrane insertion)

  • Complementation testing in oppC deletion strains to verify functionality

  • Live-cell imaging under various growth conditions and peptide availability

  • Analysis of colocalization with other Opp components using dual-color imaging

  • Quantification of cluster size, density, and dynamics using specialized software

Correlative Light and Electron Microscopy (CLEM) can further connect fluorescence patterns with ultrastructural context, particularly valuable for understanding OppC localization relative to cell wall features and membrane microdomains.

These advanced imaging approaches reveal not just where OppC resides in the cell, but how its distribution changes in response to environmental conditions, substrate availability, and interactions with other cellular components.

How can researchers design experiments to measure OppC-mediated peptide transport kinetics?

Designing experiments to accurately measure OppC-mediated peptide transport kinetics requires sophisticated approaches that capture real-time transport activity. Several complementary methodologies can be employed:

For direct measurement of peptide uptake, researchers can use radiolabeled or fluorescently labeled peptide substrates. A systematic approach involves:

  • Prepare B. subtilis cells expressing wild-type or mutant OppC

  • Incubate cells with labeled peptides at various concentrations (0.1-100 μM)

  • At defined time points (15s to 10min), filter cells and wash to remove unbound peptides

  • Quantify internalized peptides via scintillation counting or fluorescence measurement

  • Calculate initial uptake rates and derive kinetic parameters (Km, Vmax)

Competition assays provide valuable insights into substrate specificity. By measuring the uptake of a reporter peptide in the presence of varying concentrations of unlabeled competitors, researchers can determine relative affinity for different substrates. Evidence shows that tri-L-alanine competes with antibiotics like GE81112 for the Opp transporter, indicating shared transport pathways .

For more detailed mechanistic studies, reconstitution of purified OppC (along with other Opp components) into proteoliposomes allows precise control of conditions on both sides of the membrane. Researchers can then measure ATP consumption coupled to peptide translocation, providing direct correlation between energy utilization and transport activity.

A complementary approach leverages the observation that certain antibiotics utilize the Opp system for cellular entry. By measuring growth inhibition zones in the presence of varying peptide concentrations, researchers can indirectly assess transport competition kinetics, as demonstrated with GE81112 and tri-L-ornithine .

What approaches can be used to identify protein-protein interactions between OppC and other components of the Opp system?

Understanding the protein-protein interactions between OppC and other components of the Opp system is crucial for elucidating the transport mechanism. Several complementary approaches can effectively map these interactions:

In vivo crosslinking coupled with mass spectrometry provides a powerful method to capture transient interactions. This approach involves:

  • Treatment of intact cells with membrane-permeable crosslinkers like formaldehyde or DSP

  • Isolation of crosslinked complexes via affinity purification of tagged OppC

  • Proteomic analysis to identify interacting partners

  • Validation using reciprocal pulldowns with other Opp components

Split-protein complementation assays offer another effective strategy. By fusing complementary fragments of a reporter protein (such as split-GFP or split-luciferase) to OppC and potential interaction partners, researchers can visualize interactions through reconstitution of fluorescence or luminescence activity when proteins come into proximity.

For detailed mapping of interaction interfaces, cysteine scanning mutagenesis combined with disulfide crosslinking provides residue-level resolution. This methodology involves:

  • Introducing single cysteine substitutions throughout OppC and partner proteins

  • Expressing pairs of cysteine variants and inducing disulfide formation

  • Analyzing crosslinking patterns by non-reducing SDS-PAGE

  • Mapping interaction sites based on crosslinking efficiency

Förster Resonance Energy Transfer (FRET) microscopy using fluorescently tagged Opp components can reveal not only the occurrence of interactions but also their subcellular localization and dynamics in response to substrate availability or transport activity.

Bacterial two-hybrid systems adapted for membrane proteins, such as BACTH (Bacterial Adenylate Cyclase Two-Hybrid), provide a genetic approach to screen for interactions between OppC and other proteins, including those outside the core Opp system that might influence its function .

How do researchers interpret contradictory results in OppC functional studies?

When confronted with contradictory results in OppC functional studies, researchers should implement a systematic approach to resolve discrepancies. Contradictions often arise from variations in experimental conditions, strain backgrounds, or methodological differences. To address these issues:

First, thoroughly examine strain backgrounds. Evidence suggests that different laboratory strains of B. subtilis and E. coli may contain spontaneous mutations in opp genes that affect transport function. For instance, research has shown that while E. coli MG1655 is sensitive to GE81112 (MIC = 0.06 μg/μL), derived strains like DH5α are resistant (MIC > 350 μg/μL) due to mutations within the opp genes . Therefore, sequencing the opp operon in all experimental strains is essential before comparing functional data.

Second, consider the composition of growth media. The presence of competing peptides or amino acids can significantly influence OppC-mediated transport. Studies have demonstrated that tri-L-alanine decreases the inhibitory activity of GE81112 by competing for the Opp transporter, while L-leucine potentiates activity by inducing opp expression and reducing levels of the transcriptional repressor Lrp . Standardizing media composition or accounting for these effects in data interpretation is crucial.

Third, evaluate protein expression levels. Contradictory functional results may reflect differences in OppC abundance rather than intrinsic activity. Quantitative Western blotting should be employed to normalize transport activity to protein levels.

Fourth, consider potential interactions with other cellular systems. Recent research indicates that nanoparticles can differentially affect oligopeptide ABC transporters, including OppABCDF, altering transport functions through physiological adaptations rather than direct inhibition . These complex interactions may explain apparently contradictory results observed under different conditions.

Finally, employ complementation studies to confirm phenotypic observations. As demonstrated with E. coli DH5α, sensitivity to transport-dependent antibiotics can be restored by expression of either oppA or oppBCDF genes, suggesting redundancy or compensatory mechanisms that may confound simple interpretations of functional data .

What controls are essential when studying recombinant OppC in heterologous expression systems?

When studying recombinant OppC in heterologous expression systems, implementing comprehensive controls is essential for meaningful data interpretation. The following controls should be considered mandatory:

First, negative controls must include host strains carrying empty vectors to account for background activities and potential artifacts from the expression system itself. Additionally, researchers should include oppC deletion mutants transformed with the expression vector to establish baseline transport activities in the absence of functional OppC. Evidence from antibiotic sensitivity assays demonstrates that E. coli strains lacking OppC show no inhibition zones with GE81112 or tri-L-ornithine, providing a clear negative control phenotype .

Second, positive controls should include the wild-type B. subtilis OppC expressed under identical conditions. This provides a reference point for normal function. When possible, complementation of oppC-deficient strains with the wild-type gene confirms that the expression system supports functional protein production. Table 3 in the research literature shows that sensitivity to transport-dependent antibiotics can be fully restored in oppC mutants through genetic complementation .

Third, expression level controls are critical, as variation in protein abundance can confound functional assessments. Western blotting with antibodies against OppC or its affinity tag should be performed in parallel with functional assays. Additionally, membrane fraction analysis ensures proper localization, as misfolded membrane proteins may aggregate in inclusion bodies or be targeted for degradation.

Fourth, specificity controls using competing substrates help confirm that observed activities are indeed mediated by OppC. For example, tri-L-alanine competition assays can verify that transport occurs via the Opp system rather than alternative pathways .

Fifth, when using fluorescent tags or fusion proteins, researchers must verify that these modifications do not disrupt protein function. This can be accomplished by comparing transport activities of tagged and untagged versions or through complementation assays in oppC deletion strains.

Finally, time-course experiments during induction help identify optimal expression windows before potential toxic effects of membrane protein overexpression occur, which typically manifest as growth inhibition or altered cell morphology.

What statistical approaches are appropriate for analyzing OppC transport kinetics data?

For basic kinetic parameters, non-linear regression analysis should be applied to fit experimental data to established models like Michaelis-Menten kinetics. This yields essential values such as Km (reflecting substrate affinity) and Vmax (maximum transport rate). The goodness of fit should be evaluated using R² values and residual plots to validate model selection. When comparing wild-type OppC with mutant variants, extra sum-of-squares F-tests can determine whether differences in kinetic parameters are statistically significant.

For time-course uptake experiments, repeated measures ANOVA is appropriate when comparing multiple conditions over time. This approach accounts for the correlation between measurements from the same experimental unit at different time points. Post-hoc tests with correction for multiple comparisons (such as Tukey's or Bonferroni) should follow significant ANOVA results to identify specific differences between conditions.

Competition assays, where unlabeled peptides compete with labeled substrates, are commonly used to assess substrate specificity. These data are best analyzed using IC50 determination through sigmoidal dose-response curve fitting. Converting IC50 values to Ki using the Cheng-Prusoff equation provides inhibition constants that can be compared across different experimental conditions.

For complex datasets comparing multiple variables (such as different substrates, inhibitors, and OppC variants), multivariate statistical approaches may be necessary. Principal component analysis (PCA) can identify patterns in transport behavior across different conditions, while hierarchical clustering can group substrates or OppC variants with similar kinetic profiles.

To account for biological variability, all experiments should include at least three biological replicates. Power analysis should be conducted beforehand to determine appropriate sample sizes for detecting meaningful differences. When reporting results, both mean values and measures of dispersion (standard deviation or standard error) should be provided, along with exact p-values rather than threshold-based significance statements.

How can researchers troubleshoot low expression yields of recombinant OppC?

Low expression yields of recombinant OppC present a common challenge in research studies. As a transmembrane protein, OppC poses specific difficulties during heterologous expression. A systematic troubleshooting approach can address these issues effectively:

First, evaluate promoter strength and induction conditions. Research with B. subtilis expression systems has demonstrated that IPTG-inducible promoters like P-spac or the strong promoter derived from the B. subtilis groE operon can achieve high expression levels . If using IPTG induction, titrate concentrations between 0.1-1.0 mM and test different induction temperatures (16-37°C) and durations (4-24 hours). Lower temperatures often improve membrane protein folding efficiency.

Second, modify the expression construct design. Consider the following optimizations:

  • Add fusion tags that enhance stability (such as MBP or SUMO)

  • Optimize the ribosome binding site strength and spacing

  • Include rare codon optimization for B. subtilis

  • Test both N- and C-terminal affinity tags to identify positions that minimize interference with membrane insertion

Third, address potential toxicity issues. Membrane protein overexpression frequently causes cell toxicity due to membrane crowding or saturation of insertion machinery. Strategies to mitigate toxicity include:

  • Utilizing tightly regulated promoters with minimal leaky expression

  • Reducing growth temperature during induction to slow expression rate

  • Co-expressing chaperones that assist membrane protein folding

  • Using specialized strains with enhanced membrane protein expression capacity

Fourth, modify growth and induction protocols. Evidence suggests that induction during mid-logarithmic growth phase optimizes the balance between biomass accumulation and protein expression. Additionally, supplementing media with glycine (0.5-1%) can increase membrane fluidity and accommodate additional membrane proteins.

Fifth, optimize extraction and detection methods. Low apparent yields may result from inefficient protein extraction rather than expression issues. For membrane proteins like OppC, specialized detergents (DDM, LDAO, or Fos-choline) may be required for effective solubilization. Western blotting with antibodies against both N- and C-terminal tags can help determine if proteolysis is occurring.

Finally, consider co-expression of other Opp components. Research indicates that membrane proteins often exhibit enhanced stability and expression when co-expressed with their natural binding partners . Co-expressing OppB with OppC may improve yields by facilitating proper folding and assembly of the transmembrane domain complex.

What emerging technologies might advance our understanding of OppC structure and function?

Emerging technologies offer exciting possibilities for advancing our understanding of OppC structure and function beyond current limitations. Cryo-electron microscopy (cryo-EM) represents a revolutionary approach for membrane protein structural determination without crystallization. This technique could reveal the three-dimensional architecture of the entire OppABCDF complex, providing unprecedented insights into how OppC contributes to the transport pore and interacts with other components .

Single-molecule techniques are increasingly applicable to membrane transport studies. Single-molecule FRET (smFRET) can capture conformational changes in OppC during the transport cycle, revealing the dynamic structural rearrangements that facilitate peptide translocation. Similarly, high-speed atomic force microscopy (HS-AFM) enables direct visualization of membrane proteins under near-physiological conditions, potentially capturing OppC's movements during transport in real-time.

Integrative structural biology approaches combining multiple experimental techniques with computational modeling hold great promise. Cross-linking mass spectrometry data can establish distance constraints between residues, while molecular dynamics simulations can predict conformational changes during substrate binding and translocation. Together, these methods could generate comprehensive models of OppC function that bridge atomic-level details with macroscopic transport phenomena.

CRISPR-based technologies offer new avenues for studying OppC in its native context. CRISPRi approaches can achieve tunable repression of oppC expression, allowing dose-dependent phenotypic studies, while CRISPR-mediated precise genome editing facilitates the introduction of specific mutations or fusion tags at the endogenous locus, maintaining native regulation .

Lastly, advances in synthetic biology present opportunities to engineer OppC variants with altered specificity or enhanced activity. Directed evolution methodologies coupled with high-throughput screening systems could generate OppC variants with novel properties, both advancing our understanding of structure-function relationships and potentially yielding transporters with biotechnological applications .

How might understanding OppC function contribute to developing novel antimicrobial strategies?

The oligopeptide permease system, with OppC as a critical component, represents a promising target for novel antimicrobial strategies. Research has demonstrated that certain antibiotics, including GE81112 and tri-L-ornithine, exploit the Opp system for entry into bacterial cells . This "Trojan horse" approach, where antimicrobial agents disguised as nutrients hijack transport systems for cellular entry, could be expanded through deeper understanding of OppC structure and substrate recognition mechanisms.

Studies comparing antibiotic sensitivity between wild-type and opp-deficient strains have shown dramatic differences in susceptibility. Wild-type E. coli strains show inhibition zones of 24-32 mm with GE81112, while opp-deficient strains show no inhibition . This stark contrast highlights the potential for developing peptide-antibiotic conjugates specifically designed to be recognized and transported by OppC and its associated components.

The specificity of the Opp system varies between bacterial species, offering opportunities for selective targeting. By understanding the unique structural features of OppC in pathogenic bacteria compared to commensal species, researchers could design antimicrobial peptides with preferential uptake by harmful bacteria. This approach could reduce collateral damage to beneficial microbiota, addressing a major limitation of current broad-spectrum antibiotics.

Additionally, nanoparticle interactions with the Opp system suggest potential for novel delivery strategies. Research has shown that metal oxide nanoparticles like n-ZnO and n-TiO2 impact the expression and function of oligopeptide transporters . This knowledge could be leveraged to develop antimicrobial nanoparticles that either target or exploit OppC-mediated transport for enhanced efficacy.

Furthermore, combination therapies targeting both the Opp system and downstream cellular processes could overcome resistance mechanisms. By simultaneously compromising nutrient acquisition through OppC inhibition while targeting essential cellular functions, such approaches could create synergistic effects that minimize resistance development.

As antibiotic resistance continues to threaten global health, these OppC-targeted strategies represent promising avenues for antimicrobial development that differ fundamentally from conventional approaches targeting cell wall synthesis or protein translation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.