Recombinant Bacillus subtilis Penicillin-binding protein H (pbpH)

Shipped with Ice Packs
In Stock

Description

Overview of pbpH

Penicillin-binding proteins (PBPs) catalyze the cross-linking of PG chains, essential for bacterial cell shape and division. pbpH is one of 16 PBPs encoded by B. subtilis, belonging to the class B PBPs with transpeptidase activity . It shares functional redundancy with PBP2a (encoded by pbpA), particularly in maintaining rod-shaped morphology .

Key Features of Recombinant pbpH

ParameterDetail
GenepbpH (Q796K8)
Expression HostE. coli
TagN-terminal His-tag
LengthFull-length (1–704 amino acids)
Purity>90% (SDS-PAGE)
ActivityTranspeptidase (TP)
StorageLyophilized powder; store at -20°C/-80°C
BufferTris/PBS-based, 6% trehalose, pH 8.0

Peptidoglycan Synthesis

pbpH is a core component of the elongasome, a multiprotein complex driving cell elongation by coordinating PG synthesis. It interacts with SEDS-family transglycosylases (e.g., RodA) and cytoskeletal proteins (e.g., MreB) .

Redundancy with PBP2a

FeaturepbpHPBP2a
FunctionCell elongation, rod shapeCell elongation, rod shape
LocalizationMembrane-associated patchesMembrane-associated patches
pH SensitivityInactivated at pH 8.5Retains activity under alkaline
EssentialityNon-essential aloneNon-essential alone
Double KnockoutLethal (growth defect)Lethal (growth defect)

This redundancy ensures survival under stressors like alkaline shock, where pbpH is inactivated, while PBP2a compensates .

Response to Environmental Stress

Under alkaline conditions (pH 8.5–10.5):

  1. pbpH Activity Loss: Full inactivation at pH 8.5, likely due to pH-dependent structural instability .

  2. PBP2a Compensation: Retains activity, enabling continued PG synthesis .

  3. PBP1 Isoform Shift: Transition from PBP1a to PBP1b (smaller, active form) at pH 10.5 .

Antibiotic Resistance Studies

pbpH’s β-lactam binding domain makes it a target for β-lactam antibiotics. Its inactivation under alkaline conditions highlights pH-dependent susceptibility, relevant for developing pH-specific therapies .

Cell Wall Dynamics

  • Localization Studies: GFP/RFP-tagged pbpH colocalizes with LipidII patches, marking active PG synthesis sites .

  • Mechanistic Insights: pbpH’s interaction with RodA and MreB demonstrates coordinated PG synthesis during elongation .

Challenges and Future Directions

  1. pH-Dependent Regulation: Further studies are needed to elucidate how pbpH’s activity is modulated by environmental pH, including post-translational modifications .

  2. Redundancy Mechanisms: Investigating how pbpH and PBP2a coordinate during stress responses could inform strategies to target bacterial survival pathways.

  3. Therapeutic Targeting: Exploiting pbpH’s structural differences from PBP2a for species-specific antibiotic development.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet customer needs.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a particular tag type, please inform us, and we will prioritize its development.
Synonyms
pbpH; ykuA; BSU13980; Penicillin-binding protein H
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-704
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
pbpH
Target Protein Sequence
MTEIGREPKKKRKGNRAIRMNLFFLAVFVLFTALIFKLGVVQIVEGEQHEEDAEKSNAKT AYYPAPRGKMYDRNQKVAVDNQSVPEIVYVSTSSTKTEDKIKTAKRLASFIHIDTEFLKE RDLRDYWIAAHPKKAAALLKESESNLKGDQAYKLQIERVPDQELKAIQQDDEEMETAAIY TRFSSGNAYEPQIVKAMNPNKSNSNGKNGALLDEKKNSSQRPKNDLTYDEISIVSEHLEE LPGIDIVNDWTRKYPYDKTLYSVFGGVTTPDQGLLSDRKDFYLTRGYANNDRVGKSYLEY QYEEYLNSHKEKVEYVEDNKGNVVSQKTIDKGSRGYDLQLSFDMELQAKVEKIIEEEVRN SRARGNYMLDRAFAVMMDPNNGDILSMAGKKIDLKTNKIEDYAIGAFTTQYEMGSAVKGA TVLAGYQDGIPHYKYYIDAPMLLGTNLIKKSYTNMGTINELTALQKSSNVYMFNVAMHIA GVTYKPHGSLPADQNDLLKMRNYYSQFGLGVKTGIDLPQESAGMQTTPKTVGGLILDLAI GQYDTYTPLQMAQYISVIANGGYRVQPRIVTSIHKPGKKDQLGKAIEHRKPKVLNKINNS ESDLKQVQTGMKLVTSSGTAKNTFTEDVSGKTGTAETFYYGTNRNWWGKKTYNLTFVGYY PSKKPKVAFSVVVPSVDDDDKINKIIAKRAIHAYAELEKKHSKK
Uniprot No.

Target Background

Function

Recombinant Bacillus subtilis Penicillin-binding protein H (pbpH) is involved in peptidoglycan polymerization. It plays a redundant role with PBP-2A (pbpA) in maintaining cell rod shape during vegetative growth and spore outgrowth.

Database Links
Protein Families
Transpeptidase family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is PbpH and what is its role in Bacillus subtilis?

PbpH is a class B penicillin-binding protein in B. subtilis that plays a redundant role with PBP2a (encoded by pbpA) in determining rod cell shape. Sequence alignment reveals that PbpH is most similar to B. subtilis PBP2a (42% identical and 60% similar) and E. coli PBP2 (22% identical and 40% similar) . Class B PBPs typically carry transpeptidase activity that cross-links peptidoglycan strands via their peptide side chains, contributing to cell wall synthesis and structural integrity .

What is the expression pattern of pbpH in B. subtilis?

The pbpH gene is expressed only during vegetative growth, with expression levels increasing progressively during log phase, peaking during early stationary phase, and then decreasing as cells progress into sporulation . Notably, no expression is observed during the first 2 hours of spore germination and outgrowth. The peak expression level of pbpH is very low compared to other PBP-encoding genes, making its protein product difficult to detect .

How is the pbpH gene regulated at the transcriptional level?

Primer extension mapping has identified a transcription start site 102 bases upstream of the originally predicted pbpH start codon. The sequence upstream of this apparent transcription start site contains reasonable matches to σA-dependent promoter consensus recognition sequences . The mechanism of growth phase-dependent expression of pbpH requires further study for complete characterization.

What expression systems are suitable for recombinant production of B. subtilis PbpH?

Recombinant PbpH can be successfully expressed in E. coli systems. The process requires insertion of the target DNA fragment into an E. coli expression vector (typically a plasmid vector) and transformation into E. coli cells . For controlled expression studies in B. subtilis itself, xylose-inducible expression systems have been successfully employed . When designing expression constructs, careful consideration should be given to the true translation start site of PbpH, as alignment of signal peptide hydrophobic cores and conserved residues from other B. subtilis class B PBPs suggests that the previously annotated start codon may be incorrect .

What are the optimal conditions for inducing recombinant PbpH expression?

For xylose-inducible expression systems in B. subtilis, growth in medium lacking glucose with addition of xylose to a final concentration of 0.4% (for functional studies) or 2% (for maximum expression) has been successful . For E. coli expression systems, standard induction protocols can be applied, followed by harvesting cells by centrifugation and sample preparation for protein detection by polyacrylamide gel electrophoresis and subsequent staining or immunoblotting .

What purification strategies are effective for recombinant PbpH?

While specific purification strategies for PbpH are not detailed in the search results, general approaches for recombinant PBPs include affinity chromatography using His-tags or other fusion tags. For example, PBP3 from B. subtilis has been successfully expressed with a His-tag and purified to >90% purity suitable for SDS-PAGE analysis . Similar strategies would likely be applicable to PbpH purification, with appropriate optimization of buffer conditions to maintain protein stability and activity.

How does PbpH contribute to cell morphology in B. subtilis?

PbpH and PBP2a play redundant, essential roles in maintaining rod shape in B. subtilis. Deletion of either gene alone does not cause significant morphological changes, but a double mutant lacking both genes is not viable unless complemented with one of the genes under inducible control . When PbpH expression is depleted in a pbpA mutant background, cells transition from rod-shaped to ovoid/round shapes and eventually lyse, indicating that at least one of these proteins is required for proper cell morphology .

What methodologies are effective for studying PbpH localization and dynamics in cells?

While specific methodologies for PbpH are not detailed in the search results, approaches used for other PBPs would be applicable. These include:

  • Fluorescence microscopy with GFP fusions to track protein localization

  • Immunofluorescence microscopy with specific antibodies

  • Time-lapse microscopy to track dynamics during cell growth and division

For example, studies with E. coli PBP2 (a homolog of B. subtilis PbpH) have shown that it localizes preferentially in the lateral wall and at mid-cell compared to the old cell pole . Similar approaches could be applied to study PbpH localization and dynamics.

How can researchers effectively measure PbpH enzymatic activity?

Although specific assays for PbpH activity are not described in the search results, standard approaches for measuring transpeptidase activity of PBPs include:

  • Radiolabeled penicillin binding assays

  • BOCILLIN™ FL (fluorescent penicillin) binding assays

  • Peptidoglycan cross-linking assays using purified cell wall components

It's worth noting that attempts to detect PbpH with radiolabeled penicillin have been unsuccessful, potentially due to very low expression levels, lack of membrane association, co-migration with other PBPs on SDS-PAGE, or low affinity for the particular β-lactam used . These challenges should be considered when designing enzymatic assays.

What phenotypic assays are most informative for characterizing pbpH mutants?

Based on the search results, the following phenotypic assays have provided valuable insights:

  • Growth rate analysis: Measuring doubling times in different media conditions

  • Microscopy: Phase contrast and electron microscopy to assess cell morphology, including cell length, width, and septum formation

  • Antibiotic sensitivity: Determining MICs of various β-lactam antibiotics can reveal differences in binding specificities between PBPs

  • Peptidoglycan structure analysis: HPLC analysis of muropeptides to detect potential structural changes in the cell wall

  • Sporulation efficiency: Measuring heat resistance and chloroform resistance of spores

  • Germination and outgrowth analysis: Monitoring the ability of spores to germinate and outgrow under different conditions

How can genetic interaction studies be designed to elucidate PbpH function?

The search results demonstrate that constructing multiple mutants lacking various combinations of PBP-encoding genes has been highly informative. For instance, the lethality of the pbpA pbpH double mutant revealed their redundant, essential roles .

Table 1: Relevant B. subtilis strains for studying PbpH genetic interactions

StrainGenotypeKey characteristics
DPVB133ΔpbpH::SppbpH deletion, no significant phenotype
DPVB171pbpC::Cm ΔpbpH::SpDouble mutant with normal morphology
DPVB202ΔpbpH::Sp amyE::xylAp-pbpH::CmConditional pbpH expression
DPVB207pbpA::Erm ΔpbpH::Sp amyE::xylAp-pbpH::CmViability dependent on xylose-induced pbpH expression

To design effective genetic interaction studies:

  • Create single and multiple deletion mutants of PBP-encoding genes

  • Use conditional expression systems for essential combinations

  • Analyze morphological, growth, and cell wall phenotypes

  • Consider interactions with other cell shape determinants (e.g., RodA, MreB)

How does PbpH contribute to antibiotic resistance in B. subtilis?

The search results indicate that pbpH and pbpA mutants exhibit different changes in sensitivity to various β-lactam antibiotics. The pbpH mutant shows increased resistance to cephalexin, amdinocillin, and piperacillin, while the pbpA mutant shows increased sensitivity to these antibiotics . This suggests that PbpH and PBP2a have different binding specificities for β-lactam antibiotics. The presence of redundant PBPs with different β-lactam sensitivities may allow B. subtilis to compete under a wider range of environmental conditions where it might encounter antibiotics produced by competitors .

Table 2: MICs (μg/ml) of selected antibiotics for PBP mutants

StrainRelevant genotypeCephalexinMecillinamPiperacillin
PS832Wild type0.1350.25
PS2465pbpA0.061.80.13
DPVB133pbpH0.25100.5

What is the relationship between PbpH and cell wall synthesis machinery during different growth phases?

Current models of bacterial cell wall synthesis suggest that distinct wall-synthetic complexes act in alternating fashion to drive cell elongation by insertion of peptidoglycan into the cylindrical wall, followed by septum production . PbpH and PBP2a are predicted to function as transpeptidases in complexes with peptidoglycan glycosyl transferases and other proteins that direct the localization of their activities .

One protein consistently associated with these class B PBPs is RodA, a member of the SEDS (shape, elongation, division, and sporulation) family . In the absence of the cylindrical wall synthetic machinery (when both PBP2a and PbpH are missing), peptidoglycan synthesis appears to be carried out primarily by the septum synthetic machinery, leading to round cells and aberrant septa .

The differential expression of pbpH (highest in late log phase) and pbpA (beginning during spore outgrowth and increasing throughout vegetative growth) suggests they may have specialized roles during different growth phases .

How can CRISPR-Cas9 technology be applied to study PbpH function?

While the search results don't specifically address CRISPR-Cas9 studies of PbpH, they do describe CRISPR-Cas9 systems developed for B. subtilis that could be applied to PbpH research . A highly efficient method for generating large genomic deletions in B. subtilis without leaving traces of foreign DNA has been established .

For studying PbpH, CRISPR-Cas9 could be used to:

  • Create precise deletions or mutations in the pbpH gene

  • Introduce fluorescent protein tags at the native locus

  • Modify regulatory elements to alter expression patterns

  • Create scarless multiple mutations for genetic interaction studies

The system requires:

  • A SpCas9-expressing plasmid (e.g., pHCas9)

  • A second plasmid containing sgRNA targeting pbpH and a donor DNA template

  • Homology-directed repair to introduce desired modifications

Transformation efficiency can be improved through prolonged incubation under selective pressure, with reported efficiency increases from 66.8% to 96.8% for gene insertions .

What are the best methods for analyzing peptidoglycan structure in pbpH mutants?

While no clear differences in peptidoglycan structure have been detected between wild-type and pbpH mutant strains using standard muropeptide analysis , more sensitive approaches could potentially reveal subtle structural changes. Recommended methodologies include:

  • HPLC analysis of muropeptides: Digestion of peptidoglycan with muramidases followed by reversed-phase HPLC to separate and quantify muropeptides

  • Mass spectrometry: For detailed structural characterization of muropeptides

  • Glycan chain length analysis: To detect potential differences in the three-dimensional arrangement of glycan strands and cross-links

  • Atomic force microscopy: To visualize cell wall architecture at nanoscale resolution

  • Cryo-electron microscopy: To examine cell wall ultrastructure in near-native state

It's important to note that the different shapes of poles and cylindrical walls may derive from differences in the three-dimensional arrangement of glycan strands and cross-links, which can be lost during muramidase digestion to produce muropeptides .

How can researchers effectively study interactions between PbpH and other cell wall synthesis proteins?

Several approaches could be employed to study protein-protein interactions involving PbpH:

  • Bacterial two-hybrid assays: To screen for potential interacting partners

  • Co-immunoprecipitation: Using tagged versions of PbpH to pull down interacting proteins

  • Fluorescence resonance energy transfer (FRET): To study interactions in living cells

  • Co-localization studies: Using fluorescently tagged proteins to examine spatial relationships

  • Crosslinking coupled with mass spectrometry: To identify interaction sites

Particular attention should be paid to potential interactions with RodA, which is believed to interact with PBP2a and likely also interacts with PbpH in the cylindrical wall synthetic machinery . The presence of a single rodA ortholog in the B. subtilis genome suggests this gene product functions with both PBP2a and PbpH .

What biophysical techniques are suitable for characterizing recombinant PbpH?

Based on approaches used for other PBPs, the following biophysical techniques would be suitable for characterizing recombinant PbpH:

  • Size exclusion chromatography: To determine the oligomeric state in solution

  • Circular dichroism: To assess secondary structure content and thermal stability

  • Differential scanning calorimetry: For detailed thermal stability analysis

  • Surface plasmon resonance: To measure binding affinity to β-lactams and other ligands

  • X-ray crystallography or cryo-EM: To determine three-dimensional structure

  • Isothermal titration calorimetry: To measure binding thermodynamics

For example, studies of B. subtilis PBP4* have shown that both the full-length protein and its N-terminal penicillin-binding domain are monomeric in solution and retain the same thermal stability . Similar approaches could be applied to characterize PbpH.

How can advanced imaging techniques enhance our understanding of PbpH function?

Advanced imaging techniques that could be applied to study PbpH include:

  • Super-resolution microscopy: Techniques like PALM, STORM, or STED microscopy could reveal the precise localization and dynamics of PbpH at sub-diffraction resolution

  • Single-molecule tracking: To follow the movement of individual PbpH molecules in living cells

  • Cryo-electron tomography: To visualize the cellular context of PbpH in three dimensions

  • Correlative light and electron microscopy: To link fluorescence signals to ultrastructural features

  • Expansion microscopy: To physically enlarge cellular structures for improved resolution

These approaches could reveal how PbpH localizes relative to other cell wall synthesis proteins and how its distribution changes during the cell cycle and in response to antibiotic treatment.

What computational approaches can be used to predict PbpH structure and function?

Computational approaches that could provide insights into PbpH include:

  • Homology modeling: Using known structures of related class B PBPs to predict PbpH structure

  • Molecular dynamics simulations: To study protein flexibility and potential conformational changes

  • Docking simulations: To predict interactions with β-lactams and natural substrates

  • Coevolution analysis: To identify potential interaction partners based on correlated evolutionary patterns

  • Systems biology approaches: To integrate PbpH into cell wall synthesis network models

These computational approaches could guide experimental design and provide hypotheses about PbpH function that can be tested experimentally.

How might high-throughput screening approaches be applied to study PbpH inhibitors or activators?

High-throughput approaches that could be applied include:

  • Fluorescence-based binding assays: Using fluorescent penicillin derivatives to screen for competitive binding

  • Cell-based screens: Monitoring morphological changes in B. subtilis strains with modified PbpH expression

  • Enzymatic assays: Measuring transpeptidase activity in the presence of potential modulators

  • Fragment-based screening: To identify novel molecular scaffolds that interact with PbpH

  • Virtual screening: Computational screening of compound libraries against PbpH structural models

These approaches could identify specific inhibitors or activators of PbpH that might serve as research tools or even lead to new antibiotics with selective activity against specific bacterial species.

What are the key unanswered questions regarding PbpH function?

Several important questions remain to be addressed:

  • What is the precise mechanism by which PbpH contributes to rod shape determination?

  • How do PbpH and PBP2a coordinate their activities during different growth phases?

  • What are the specific protein-protein interactions involving PbpH in the cell wall synthesis machinery?

  • Why does B. subtilis maintain two PBPs with apparently redundant functions?

  • Are there conditions under which PbpH plays a non-redundant, essential role?

  • What is the three-dimensional structure of PbpH and how does it differ from PBP2a?

  • How is PbpH expression regulated at the transcriptional and post-transcriptional levels?

  • What is the true translation start site of PbpH?

How might synthetic biology approaches advance PbpH research?

Synthetic biology approaches could include:

  • Engineering strains with orthogonal PBP systems: Creating B. subtilis strains with engineered PbpH variants that respond to non-natural ligands

  • Minimal cell wall synthesis systems: Reconstituting minimal peptidoglycan synthesis machinery in vitro or in heterologous hosts

  • Biosensors: Developing reporters that respond to changes in cell wall structure or tension

  • Directed evolution: Evolving PbpH variants with enhanced activity or altered specificity

  • Synthetic gene circuits: Creating feedback systems that regulate PbpH expression in response to cell shape changes

These approaches could provide new tools for studying PbpH function and potentially lead to novel antimicrobial strategies.

What potential applications might emerge from improved understanding of PbpH?

Improved understanding of PbpH could lead to:

  • Novel antibiotics: Targeting specific PBPs with non-redundant functions to reduce resistance development

  • Probiotics with enhanced survival: Engineering B. subtilis strains with modified PbpH expression for improved intestinal colonization

  • Biocontainment strategies: Creating bacterial strains dependent on synthetic PbpH variants

  • Cell factories with optimized morphology: Engineering bacterial shape for improved protein secretion or metabolite production

  • Diagnostic tools: Using PbpH binding specificity differences to identify bacterial species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.