Recombinant Bacillus subtilis Probable ABC transporter permease protein yesP (yesP)

Shipped with Ice Packs
In Stock

Description

Introduction

The Bacillus subtilis YqgI protein, encoded by the yqgI gene (synonym: yzmD; UniProt ID: P46340), is classified as a probable ATP-binding cassette (ABC) transporter permease. ABC transporters are integral membrane proteins responsible for the ATP-driven translocation of substrates across cellular membranes, playing critical roles in nutrient uptake, toxin efflux, and stress responses in bacteria . Recombinant production of YqgI enables functional and structural studies to elucidate its role in B. subtilis physiology. This review synthesizes current knowledge on YqgI, including its genomic context, structural features, recombinant expression systems, and potential applications.

2.1. Protein Architecture

YqgI is a 294-amino acid protein with a molecular weight of approximately 33 kDa . Key structural features include:

  • Transmembrane domains: Predicted to form six α-helical membrane-spanning regions.

  • Conserved motifs: Contains Walker A and Walker B motifs critical for ATP hydrolysis .

  • Extracellular loops: A large extracellular loop (residues 50–200) implicated in substrate recognition .

Table 2: Recombinant Production Parameters

ParameterDetails
HostE. coli BL21(DE3)
TagN-terminal His-tag
Purification MethodImmobilized metal affinity chromatography (IMAC)
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS with 6% trehalose (pH 8.0)

3.2. Challenges and Solutions

  • Proteolytic degradation: Addressed using protease-deficient B. subtilis strains (e.g., WB800) .

  • Secretion efficiency: Optimized via signal peptide screening (e.g., SacB, AmyE) .

4.1. Substrate Specificity

While YqgI’s exact substrate remains unconfirmed, homology modeling and genomic context suggest involvement in:

  • Peptide uptake: Similar to Opp (oligopeptide) and Dpp (dipeptide) transporters .

  • Stress response: Upregulated under cell wall stress (e.g., bacitracin exposure) .

4.2. Role in Antibiotic Resistance

ABC transporters like YqgI may contribute to resistance via:

  • Efflux mechanisms: Export of antimicrobial compounds .

  • Target protection: Shielding cellular targets (e.g., undecaprenyl phosphate in peptidoglycan synthesis) .

5.1. Biotechnological Applications

  • Drug discovery: Target for novel antibiotics targeting Gram-positive pathogens .

  • Industrial enzymes: Platform for secretory production of heterologous proteins .

5.2. Research Gaps

  • Substrate identification: Requires ligand-binding assays (e.g., isothermal titration calorimetry).

  • Structural elucidation: Cryo-EM studies to resolve full-length transporter dynamics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
yesP; BSU06980; Probable ABC transporter permease protein YesP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yesP
Target Protein Sequence
MTGNGADAMKKSRSIRKDNLAGYAFISPFIIGFLCFTVIPMGASLFLSFTSYDLFTAPKW IGLDNFKEMFTGDEKYWQSLKVTFTYVLAGVPLRLGFALFIAVILNNAAKGTAIYRTLFY LPSIIGGSVAVAIMWRNIFGNDGVINALLFFVGIDQKILWYQNPTSALWTLILLSVWQFG SSMLIFLAGLKNIPSSYLEAASVDGANRVQRFFKITLPILTPIIFFNLVMQTISAFMTFT PAYIISKGEGGPLDGTLLYSLYLFQRAFNYFQMGYASAMAWVMLVIVGLITLILFKTSSY WVHYESKEE
Uniprot No.

Target Background

Function
This protein is part of a binding-protein-dependent transport system. It is likely responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the YesP protein and what is its role in Bacillus subtilis?

YesP is a membrane-spanning domain (MSD) protein that forms part of an ABC transporter complex in Bacillus subtilis. ABC transporters typically consist of at least four domains: two membrane-spanning domains (MSDs) like YesP that create the translocation pathway, and two nucleotide-binding domains (NBDs) that provide energy through ATP hydrolysis .

Within the ABC transporter system, YesP likely functions as a permease component, forming the channel through which substrates are transported across the cell membrane. While the specific substrates of YesP-containing transporters have not been definitively characterized in the search results, it likely participates in the import or export of essential nutrients or compounds similar to other B. subtilis ABC transporters .

How are ABC transporters classified in Bacillus subtilis and where does YesP fit?

ABC transporters in B. subtilis are classified into distinct categories based on their structural architecture, functional roles, and genetic organization. According to comprehensive genome analysis, B. subtilis contains approximately 78 ABC transporters that can be divided into 38 importers and 40 extruders . These transporters are further categorized into different types based on their predicted structural topology:

TypeArchitectureExamples in B. subtilisFeatures
Type I ImportersClassical SBP-dependent13 identified in B. subtilisLack regulatory domains on NBD, SBP interacts with MSDs
Type II ImportersVitamin/metal transportersPresent in B. subtilisLarger MSDs, different substrate specificity
Type IV ExportersDrug/lipid exportersBmrA, BmrCD12 long transmembrane helices, domain-swapped configuration
Hybrid ExportersMixed architectureYjkBACombines features of different exporter types

YesP would be classified based on its structural features and genetic context. While the search results don't specifically classify YesP, researchers can determine its classification through structural prediction tools like AlphaFold-Multimer and analysis of its genetic organization .

What is the typical genetic organization of ABC transporters containing permease proteins like YesP in B. subtilis?

In B. subtilis, ABC transporter genes are typically organized into operons. A complete ABC transporter system generally includes genes encoding for nucleotide-binding domains (NBDs), membrane-spanning domains (MSDs) like YesP, and often solute-binding proteins (SBPs) .

Analysis of the B. subtilis genome identified 86 NBDs in 78 proteins, 103 MSD proteins, and 37 SBPs . The genetic organization often reflects the functionality of the transporter system. For a permease protein like YesP, you would typically expect to find it in an operon along with genes encoding its partner MSD (if it forms a heterodimeric complex) and the corresponding NBD(s) .

For accurate identification of component stoichiometry, researchers should consider both genetic proximity and structural prediction. AlphaFold and similar tools have been used to predict the 3D structure of all B. subtilis ABC transporter complexes, providing insights into protein interactions and complex formation .

What methods are most effective for expressing and purifying recombinant YesP from B. subtilis?

Expressing and purifying membrane proteins like YesP presents unique challenges due to their hydrophobic nature. Based on successful approaches with similar ABC transporter proteins, the following methodological framework is recommended:

  • Expression System Selection:

    • Use B. subtilis itself as the expression host to ensure proper folding and avoid toxicity issues

    • Consider protease-deficient strains like those in the BINGO platform to enhance stability

    • Evaluate expression in E. coli as an alternative system if B. subtilis yields are insufficient

  • Vector Design and Promoter Selection:

    • Implement double promoter systems for enhanced expression

    • Consider inducible promoters (e.g., IPTG-inducible) for controlled expression

    • Include a His-tag for purification purposes

  • Purification Strategy:

    • Solubilize membrane fractions with appropriate detergents (typically DDM or LMNG for ABC transporters)

    • Use immobilized metal affinity chromatography (IMAC) for initial purification

    • Apply size exclusion chromatography (SEC) as a polishing step

  • Quality Assessment:

    • Verify purity using SDS-PAGE (>80% purity is typically desired)

    • Confirm proper folding through circular dichroism or thermal stability assays

For optimal results, storage in PBS buffer at -20°C to -80°C is recommended for long-term stability, while short-term storage can be maintained at +4°C .

How can researchers assess the functional activity of recombinant YesP in vitro?

Assessing functional activity of ABC transporter permease proteins requires specialized approaches to evaluate transport capability and ATP hydrolysis. For YesP, consider these methodological approaches:

  • Reconstitution into Proteoliposomes:

    • Reconstitute purified YesP along with its ABC transporter complex partners into liposomes

    • Establish an appropriate ion/substrate gradient across the membrane

    • Monitor substrate transport using fluorescent probes or radiolabeled substrates

  • ATPase Activity Assays:

    • Although YesP itself is not the ATP-hydrolyzing component, its functional interaction with NBDs can be assessed

    • Measure ATP hydrolysis rates of the complete complex using colorimetric phosphate release assays

    • Compare ATPase activity in the presence and absence of potential substrates to identify transport specificity

  • Substrate Binding Assays:

    • Identify potential substrates based on homology to similar ABC transporters in B. subtilis

    • Use isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to measure binding affinities

    • Create a binding profile for various substrates to determine specificity

  • Structural Impact Analysis:

    • Analyze conformational changes upon substrate binding using hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Apply cryo-EM to visualize different conformational states during the transport cycle

These approaches should be complemented with appropriate controls, including inactive mutants of YesP or related ABC transporter components, to validate the specificity of observed activities.

What structural features distinguish YesP from other ABC transporter permeases in B. subtilis?

While the search results don't provide specific structural details about YesP, we can infer potential distinctive features based on ABC transporter structural diversity in B. subtilis:

ABC transporter MSDs like YesP typically contain multiple transmembrane helices that form the substrate translocation pathway. The specific arrangement of these helices, their length, and the presence of domain swapping can vary significantly between different transporters .

Analysis tools like AlphaFold-Multimer can predict the structure of YesP in complex with its partner proteins, revealing key features such as:

  • Transmembrane Topology: The number and arrangement of transmembrane helices determine the channel architecture. Some B. subtilis ABC transporters have domain-swapped configurations where helices from one MSD interact with those from the other .

  • Substrate Binding Pocket: The amino acid composition of the channel interior determines substrate specificity. Analyzing conserved residues within the pocket can provide insights into the types of molecules YesP might transport.

  • Interaction Interfaces: YesP will have specific interfaces for interacting with its partner MSD (if heterodimeric) and with the NBDs. These interfaces often involve coupling helices that transmit conformational changes between domains.

  • Extracellular Loops: The size and composition of extracellular loops can influence interactions with solute-binding proteins and substrate capture.

For definitive structural characterization, techniques such as cryo-EM or X-ray crystallography would be necessary, similar to approaches used for other B. subtilis ABC transporters like BmrA and BmrCD .

What are the most effective techniques for determining the substrate specificity of YesP-containing ABC transporters?

Determining substrate specificity of ABC transporters requires a multi-faceted approach combining computational prediction, biochemical assays, and genetic studies:

  • Comparative Genomic Analysis:

    • Identify homologs of YesP in related organisms with known functions

    • Analyze the genetic context of yesP, as neighboring genes often provide clues about function

    • Examine regulatory elements controlling yesP expression (e.g., repression under specific nutrient conditions)

  • Growth Phenotype Assessment:

    • Generate yesP knockout strains and assess growth in various media

    • Perform growth competition assays with wild-type strains under different conditions

    • Use chemical genetic approaches with potential substrate analogs

  • Direct Transport Assays:

    • Develop uptake/efflux assays using radiolabeled or fluorescently labeled potential substrates

    • Compare transport rates in wild-type versus ΔyesP strains

    • Measure concentration-dependent transport to determine kinetic parameters

  • Heterologous Expression Studies:

    • Express YesP and its ABC transporter partners in a heterologous host lacking similar transport systems

    • Assess the ability of the recombinant system to transport various substrates

    • Perform complementation assays in transport-deficient strains

For example, a study of the metNPQ (yusCBA) operon in B. subtilis determined its specificity for methionine transport by showing that a yusCB mutant was unable to grow in the presence of 5 μM L-methionine or 100 μM methionine sulfoxide, while it grew similarly to wild type with higher concentrations of these compounds . This indicated that the Yus ABC transporter corresponds to the sole D-methionine uptake system and one of multiple L-methionine transport systems .

How do post-translational modifications affect YesP function and complex assembly in B. subtilis?

  • Identification of Potential PTMs:

    • Analyze YesP sequence for conserved motifs that might undergo phosphorylation, glycosylation, or other modifications

    • Use mass spectrometry-based proteomics to identify actual PTMs on purified YesP

    • Compare PTM patterns between YesP expressed in different growth conditions

  • Functional Impact Assessment:

    • Generate site-directed mutants at PTM sites (e.g., phosphomimetic mutations)

    • Assess transport activity of wild-type versus mutant proteins

    • Examine complex assembly efficiency using pull-down assays or native PAGE

  • Regulation of PTMs:

    • Identify kinases or other enzymes that might modify YesP

    • Determine environmental conditions that trigger changes in PTM patterns

    • Analyze temporal dynamics of modifications during different growth phases

While the search results don't specifically address YesP PTMs, research on other ABC transporters shows that kinases can affect transporters by modifying their transcription, activity, or intracellular localization . For example, protein-protein interactions and phosphorylation events can regulate ABC transporters like ABCB1, ABCB11, ABCC1, ABCC4, and ABCG2 .

What role does YesP play in B. subtilis biofilm formation and sporulation processes?

The potential role of YesP in biofilm formation and sporulation represents an intriguing research question that connects membrane transport with complex developmental processes in B. subtilis:

  • Gene Expression Analysis:

    • Analyze yesP expression patterns during biofilm formation and sporulation using RT-qPCR or transcriptomics

    • Determine whether yesP is regulated by biofilm-specific (e.g., SinR, Spo0A) or sporulation-specific (e.g., SigE, SigK) regulators

    • Create reporter fusions (e.g., yesP promoter-GFP) to visualize expression patterns in developing biofilms

  • Phenotypic Characterization:

    • Generate yesP deletion mutants and assess biofilm architecture and sporulation efficiency

    • Perform complementation studies to confirm phenotypes

    • Conduct time-lapse microscopy to visualize biofilm development and sporulation in mutant versus wild-type strains

  • Protein Localization Studies:

    • Create fluorescently tagged YesP to track its localization during biofilm formation and sporulation

    • Use techniques similar to those employed for YeeK-GFP, which showed specific localization in the spore coat

    • Examine co-localization with known biofilm or sporulation proteins

For context, other B. subtilis proteins like YeeK have been shown to specifically assemble into the spore integument, with expression initiated 5 hours after the onset of sporulation and dependent on SigK-containing RNA polymerase and the GerE protein . Similar temporal regulation might apply to YesP if it plays a role in sporulation.

How do evolution and horizontal gene transfer contribute to the diversity of YesP and related ABC transporters in different Bacillus species?

Evolutionary analysis of YesP and related ABC transporters provides insights into functional adaptation and specialization across Bacillus species:

  • Phylogenetic Analysis Approach:

    • Construct phylogenetic trees of YesP homologs across Bacillus species and related genera

    • Identify conserved domains and variable regions that might reflect functional specialization

    • Calculate selection pressures (dN/dS ratios) to identify regions under positive or purifying selection

  • Comparative Genomic Context Analysis:

    • Examine the genetic neighborhood of yesP across species to identify conserved operonic structures

    • Identify potential horizontal gene transfer events through GC content analysis, codon usage bias, or presence of mobile genetic elements

    • Map the distribution of yesP against species phylogeny to identify discordant patterns suggestive of horizontal transfer

  • Functional Divergence Assessment:

    • Express YesP homologs from different species in a common host to compare substrate specificities

    • Identify amino acid residues potentially responsible for functional differences through mutagenesis

    • Correlate evolutionary changes with ecological niches of source organisms

For example, a study comparing B. subtilis solute-binding protein YclQ with those from the B. cereus group found varying degrees of sequence identity (59% with Bcer98-0362 from B. cereus subsp. cytotoxis NVH 391-98, and 25-32% with proteins from other B. cereus and B. anthracis strains) . Such variation reflects evolutionary divergence potentially linked to functional specialization.

What are the best experimental designs for studying YesP-substrate interactions using site-directed mutagenesis?

Site-directed mutagenesis provides powerful insights into structure-function relationships of YesP. A comprehensive experimental design should include:

  • Target Residue Selection:

    • Use multiple sequence alignments to identify conserved residues across homologous permeases

    • Apply structural predictions to identify residues lining the putative substrate pathway

    • Select charged, polar, and aromatic residues likely to interact with substrates

    • Include control mutations at surface-exposed residues not expected to affect transport

  • Mutation Strategy:

    • Create conservative mutations (e.g., Asp to Glu) to assess the importance of specific chemical properties

    • Generate non-conservative mutations (e.g., Asp to Ala) to more dramatically alter the local environment

    • Develop multiple mutants to test potential synergistic effects or compensatory interactions

  • Functional Characterization:

    • Assess expression levels and membrane localization to ensure mutations don't disrupt protein folding

    • Measure substrate binding affinities using purified proteins and biophysical techniques

    • Evaluate transport kinetics using in vivo or in vitro transport assays

    • Determine ATP hydrolysis rates of the complete complex to assess coupling efficiency

  • Structural Validation:

    • When possible, obtain structural information on mutants using cryo-EM or crystallography

    • Apply molecular dynamics simulations to predict effects of mutations on substrate interactions

    • Use accessibility studies (e.g., cysteine scanning coupled with thiol-reactive probes) to map the translocation pathway

This approach has been successfully applied to other ABC transporters in B. subtilis, revealing critical residues for substrate specificity and transport mechanics .

What are the optimal approaches for studying the dynamics of YesP conformational changes during the transport cycle?

Understanding the conformational dynamics of YesP during transport requires techniques that can capture different states of the transport cycle:

  • Cryo-EM Analysis:

    • Purify the complete ABC transporter complex containing YesP

    • Capture different conformational states by varying nucleotide conditions (apo, ATP-bound, transition state analogs)

    • Perform 3D classification to identify discrete conformational states

    • Generate movies of the transport cycle by combining structural information

  • FRET-Based Approaches:

    • Introduce fluorescent protein pairs or small fluorophores at strategic positions in YesP

    • Monitor distance changes between labeled positions during transport

    • Perform single-molecule FRET to identify short-lived intermediates

    • Use acceptor photobleaching FRET to quantify interaction efficiencies

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Expose the protein complex to deuterated buffer for various time periods

    • Analyze the pattern and rate of deuterium incorporation

    • Identify regions with differential solvent accessibility in different conformational states

    • Map dynamic regions onto structural models

  • Molecular Dynamics Simulations:

    • Build atomic models of YesP in different conformational states

    • Simulate transitions between states in a membrane environment

    • Calculate energy barriers and identify key residues involved in conformational changes

    • Validate predictions through mutagenesis of hinge regions or interaction interfaces

These approaches have been applied to B. subtilis ABC transporters like BmrA, which has been structurally characterized in both inward-facing nucleotide-free and ATP-bound conformations with dimerized NBDs .

What bioinformatic tools and databases are most valuable for predicting the structure and function of YesP and related ABC transporters?

Bioinformatic analysis provides crucial insights for experimental design and interpretation. For YesP and related ABC transporters, the following tools and approaches are particularly valuable:

  • Structural Prediction Tools:

    • AlphaFold-Multimer: Demonstrated success in predicting structures of ABC transporter complexes in B. subtilis

    • RoseTTAFold: Alternative approach for protein structure prediction

    • TOPCONS/TMHMM: For transmembrane topology prediction

    • PSIPRED: For secondary structure prediction

  • Sequence Analysis Resources:

    • Pfam/InterPro: Identification of conserved domains characteristic of ABC transporters

    • MUSCLE/Clustal Omega: Multiple sequence alignment to identify conserved residues

    • ConSurf: Mapping conservation onto structural models to identify functional sites

    • PAML: For detecting residues under positive selection

  • Specialized ABC Transporter Databases:

    • TransportDB: Comprehensive resource for membrane transport proteins

    • ABCdb: Specialized database for ABC transporters

    • SubtiList/SubtiWiki: B. subtilis-specific genomic resources

  • Functional Prediction Approaches:

    • Gene neighborhood analysis: Identifying functionally related genes in the same operon

    • Co-expression analysis: Identifying genes with similar expression patterns

    • Regulon analysis: Determining which transcription factors control yesP expression

These computational approaches can generate testable hypotheses about YesP function, substrate specificity, and evolutionary relationships. For example, AlphaFold-Multimer has successfully predicted the structures of over 70 ABC transporter complexes in B. subtilis, providing insights into their classification and potential functions .

How can recombinant YesP be utilized in the development of biosensors for specific substrates?

Recombinant YesP and its associated ABC transporter components can be engineered into biosensor systems for detecting specific substrates:

  • Reporter System Development:

    • Couple the yesP promoter or a substrate-responsive promoter to reporter genes (GFP, luciferase)

    • Engineer B. subtilis strains expressing these reporters for use as whole-cell biosensors

    • Calibrate sensor response against known substrate concentrations

  • Surface Display Approach:

    • Utilize B. subtilis spore display systems (similar to the CotB fusion system) to present YesP on spore surfaces

    • Couple with detection systems such as surface plasmon resonance or electrochemical sensors

    • Develop immobilized biosensor arrays for multi-analyte detection

  • FRET-Based Biosensors:

    • Create fusion proteins with YesP flanked by appropriate FRET pairs

    • Design systems where substrate binding induces conformational changes detectable by FRET

    • Optimize signal-to-noise ratio through protein engineering

  • Specificity Engineering:

    • Modify substrate binding pockets through site-directed mutagenesis

    • Develop variants with altered specificity for detecting non-natural compounds

    • Screen mutant libraries for enhanced sensitivity or selectivity

The BceRS-AB and PsdRS-AB promoter systems in B. subtilis have been identified as promising candidates for whole-cell biosensors that can be adjusted for high-throughput screening , suggesting similar approaches might be applicable to YesP-containing systems.

What are the potential applications of YesP in drug delivery or antimicrobial resistance research?

YesP and its ABC transporter system can be leveraged for multiple applications in drug development and antimicrobial research:

  • Antimicrobial Resistance Studies:

    • Investigate whether YesP contributes to intrinsic antibiotic resistance in B. subtilis

    • Determine if YesP can export antimicrobial compounds similar to other ABC transporters

    • Develop inhibitors of YesP as potential adjuvants to enhance antibiotic efficacy

  • Drug Delivery Systems:

    • Engineer B. subtilis spores displaying YesP or modified variants for targeted drug delivery

    • Develop systems where YesP-mediated transport can be triggered by specific stimuli

    • Create fusion proteins combining YesP domains with therapeutic peptides

  • Vaccine Development:

    • Utilize B. subtilis spore display systems incorporating YesP epitopes or fusion proteins

    • Develop recombinant B. subtilis strains expressing YesP for oral delivery of antigens

    • Explore YesP as a carrier for antigenic peptides, similar to approaches used with other B. subtilis proteins

  • Structure-Based Drug Design:

    • Use structural information about YesP to design specific inhibitors

    • Target critical regions involved in substrate binding or conformational changes

    • Develop compounds that can selectively inhibit pathogen-specific homologs of YesP

Recombinant B. subtilis spores have already been successfully used as orally delivered vaccines against tetanus, anthrax, and necrotic enteritis , suggesting similar approaches might be applicable using YesP-based systems.

What strategies can address poor expression or instability of recombinant YesP in heterologous systems?

Membrane proteins like YesP often present expression and stability challenges. Consider these methodological solutions:

  • Optimization of Expression Systems:

    • Test multiple B. subtilis strains, including protease-deficient variants like those in the BINGO platform

    • Evaluate different promoter strengths and induction conditions

    • Consider fusion partners that enhance stability (e.g., thioredoxin, MBP, or SUMO tags)

    • Implement codon optimization for the expression host

  • Protein Engineering Approaches:

    • Create truncated constructs focusing on stable domains

    • Remove flexible regions that might promote aggregation

    • Introduce stabilizing mutations based on homology models

    • Consider chimeric constructs with well-expressing homologs

  • Solubilization and Purification Optimization:

    • Screen multiple detergents and solubilization conditions

    • Test amphipols or nanodiscs for enhanced stability

    • Implement on-column detergent exchange

    • Add specific lipids that might stabilize the native conformation

  • Expression Condition Screening:

    • Vary temperature, time, and inducer concentration

    • Test expression in different growth phases

    • Consider specialized media formulations

    • Implement high-throughput screening of expression conditions

For example, Creative Biomart provides recombinant B. subtilis proteins (such as YPZK) expressed in E. coli/Yeast with His tags, achieving >80% purity by SDS-PAGE . Similar approaches could be adapted for YesP, with appropriate modifications for membrane protein expression.

How can researchers distinguish between direct and indirect effects when studying phenotypes of yesP knockout strains?

Distinguishing direct from indirect effects in knockout studies requires rigorous experimental design and multiple complementary approaches:

  • Complementation Studies:

    • Reintroduce wild-type yesP at a different genomic location

    • Use an inducible promoter to create titrated expression levels

    • Include tagged versions to confirm proper localization

    • Perform cross-species complementation with homologs

  • Point Mutation Analysis:

    • Create transport-deficient point mutants rather than complete knockouts

    • Target residues specifically involved in substrate binding or transport

    • Verify protein expression and proper localization

    • Compare phenotypes between point mutants and complete knockouts

  • Temporal Control Systems:

    • Implement inducible degradation systems (e.g., degron tags)

    • Use conditional expression systems to control timing of YesP depletion

    • Monitor immediate versus delayed phenotypic effects

    • Correlate phenotype timing with known transport kinetics

  • Multi-Omics Approaches:

    • Perform transcriptomics to identify compensatory responses

    • Conduct metabolomics to detect accumulation of potential substrates

    • Use fluxomics to track metabolic adaptations

    • Integrate datasets to distinguish primary from secondary effects

These approaches were successfully applied to the characterization of the metNPQ operon in B. subtilis, where precise growth conditions and complementation studies helped identify specific roles in methionine transport .

What emerging technologies show the most promise for advancing our understanding of YesP structure and function?

Several cutting-edge technologies are poised to revolutionize research on ABC transporters like YesP:

  • Advanced Structural Biology Techniques:

    • Cryo-electron tomography for visualizing transporters in their native membrane environment

    • Micro-electron diffraction (MicroED) for structural determination from small crystals

    • Time-resolved crystallography to capture transient conformational states

    • Integrative structural biology combining multiple data sources (cryo-EM, crosslinking MS, SAXS)

  • Single-Molecule Approaches:

    • High-speed atomic force microscopy (HS-AFM) to observe conformational dynamics in real-time

    • Single-molecule FRET with improved spatial and temporal resolution

    • Optical tweezers to measure forces involved in conformational changes

    • Nanopore recording of individual transport events

  • Advanced Genetic and Genomic Tools:

    • CRISPR-Cas9 base editing for precise genetic manipulation

    • CRISPR interference (CRISPRi) for tunable gene expression

    • High-throughput mutagenesis coupled with deep sequencing

    • Synthetic genomics approaches to create minimal transporters

  • Computational and Artificial Intelligence Approaches:

    • Enhanced molecular dynamics simulations with improved force fields

    • Machine learning for predicting substrate specificity

    • Quantum mechanics/molecular mechanics (QM/MM) for modeling transition states

    • Network analysis integrating transport systems with global cellular physiology

The recent success of AlphaFold-Multimer in predicting the structures of ABC transporter complexes in B. subtilis exemplifies how AI-based approaches are transforming the field.

How might comparative studies across different bacterial species enhance our understanding of YesP evolution and specialization?

Cross-species comparative studies provide valuable insights into functional evolution and specialization of ABC transporters:

  • Evolutionary Trajectory Analysis:

    • Reconstruct ancestral sequences to trace the evolutionary history of YesP

    • Identify gene duplication events that may have led to functional divergence

    • Map evolutionary changes to structural features to understand adaptation

    • Correlate sequence changes with ecological niches or lifestyles

  • Horizontal Gene Transfer Investigation:

    • Analyze genomic islands potentially harboring yesP homologs

    • Investigate codon usage patterns and GC content to identify foreign origin

    • Examine distribution patterns inconsistent with vertical inheritance

    • Reconstruct transfer events and subsequent adaptation

  • Functional Comparative Analysis:

    • Express YesP homologs from diverse species in a common host

    • Compare substrate specificity profiles across evolutionary distance

    • Identify residue changes responsible for altered function through chimeric proteins

    • Correlate functional differences with ecological or pathogenic lifestyles

  • Regulatory Network Evolution:

    • Compare transcriptional regulation of yesP across species

    • Identify conservation or divergence in regulatory mechanisms

    • Study co-evolution of transporters with their regulatory systems

    • Map changes in genomic context and operon structure

For context, analysis of the B. subtilis SBP YclQ showed varying sequence identity with homologs from the B. cereus group (59% identity with one homolog, 25-32% with others) , suggesting significant evolutionary divergence potentially linked to functional specialization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.