Recombinant Bacillus subtilis Probable ABC transporter permease protein yesQ (yesQ)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

YesQ is a component of ABC transporters, membrane-bound complexes that translocate substrates across cellular membranes using ATP hydrolysis . In B. subtilis, ABC transporters are critical for nutrient uptake, toxin efflux, and stress responses . The recombinant YesQ protein (UniProt ID: O31520) corresponds to residues 1–296 of the native protein and is fused to an N-terminal His tag for purification .

Primary Sequence

The amino acid sequence of YesQ is:
MEPVNQPVREAPVFERKKAGRVSPKRILFHVFTATLAVLLLYPVIWLFVSSFKESASIFTTSHSLIPDPFILSNYAEGWKGIAGQPFLTFIKNSAIIVGLSTIGAVMSSAVIAYGFARIPFKGKKFWFACMMGTLMLPHEVLMIPQYIMFAKLDWLNSFKPIVVPQFFGHAFFIFLMIQFIRTIPEELDEAARIDGCGRFACFWRIILPLIAPALATSAIFSFYWKWEELIQPLLYLNKPELYPVSLALKLFLDTESASNWGAMFAMSAVSLLPVILVFFLFQKYIVQGISTTGLK .

Expression Systems

YesQ is recombinantly produced in E. coli systems, yielding either full-length (1–296 aa) or partial constructs . Key parameters include:

ParameterDetails
HostE. coli (commonly used for high-yield expression)
TagN-terminal His tag for immobilized metal affinity chromatography (IMAC)
Purity>90% (SDS-PAGE)
FormLyophilized powder or liquid
Storage-20°C to -80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)

Reconstitution Guidelines

  • Solubilization: Reconstitute in deionized water (0.1–1.0 mg/mL).

  • Stability: Add 5–50% glycerol to prevent aggregation during long-term storage .

Role in ABC Transporter Complexes

YesQ functions as a permease subunit within ABC importers, which typically consist of:

  1. Substrate-binding protein (SBP): Captures extracellular ligands.

  2. Permease (YesQ): Forms the transmembrane channel.

  3. NBDs: Hydrolyze ATP to energize substrate translocation .

Biological Relevance

  • Antibiotic resistance: ABC transporters like YesQ may contribute to bacitracin resistance via target protection mechanisms .

  • Metabolic transport: Likely involved in importing nutrients such as amino acids or ions .

Biochemical Studies

  • Structural analysis: Used in cryo-EM or X-ray crystallography to resolve transporter conformations .

  • Functional assays: Investigate ATPase activity or substrate specificity in reconstituted lipid bilayers.

Industrial Relevance

  • Protein engineering: B. subtilis is a preferred host for recombinant protein production due to its GRAS status and secretion efficiency . YesQ serves as a model for optimizing ABC transporter expression in biomanufacturing .

Challenges and Future Directions

  • Proteolytic degradation: B. subtilis extracellular proteases can limit yields; strain engineering (e.g., WB800N protease-deficient strains) mitigates this .

  • Structural validation: AlphaFold predictions require experimental verification to confirm YesQ’s role in transporter dynamics .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in stock. However, if you have specific format preferences, kindly indicate your requirements when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method or location. We recommend contacting your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yesQ; BSU06990; Probable ABC transporter permease protein YesQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yesQ
Target Protein Sequence
MEPVNQPVREAPVFERKKAGRVSPKRILFHVFTATLAVLLLYPVIWLFVSSFKESASIFT TSHSLIPDPFILSNYAEGWKGIAGQPFLTFIKNSAIIVGLSTIGAVMSSAVIAYGFARIP FKGKKFWFACMMGTLMLPHEVLMIPQYIMFAKLDWLNSFKPIVVPQFFGHAFFIFLMIQF IRTIPEELDEAARIDGCGRFACFWRIILPLIAPALATSAIFSFYWKWEELIQPLLYLNKP ELYPVSLALKLFLDTESASNWGAMFAMSAVSLLPVILVFFLFQKYIVQGISTTGLK
Uniprot No.

Target Background

Function
This protein is part of a binding-protein-dependent transport system. It is likely responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of ABC transporter systems in B. subtilis and how does yesQ fit within this classification?

ABC transporters in B. subtilis consist of three key protein components: nucleotide-binding domains (NBDs) that hydrolyze ATP, membrane spanning domains (MSDs) that form the translocation channel, and solute-binding proteins (SBPs) that capture and deliver substrates. Comprehensive genomic analyses have identified 86 NBDs in 78 proteins, 103 MSD proteins, and 37 SBPs in B. subtilis . The yesQ protein functions as a permease (MSD) component, forming part of the transmembrane channel through which substrates are transported across the bacterial membrane.

The ABC transporter family in B. subtilis has been classified into 11 sub-families based on phylogenetic analysis of the NBDs and clustering patterns of MSDs and SBPs . Researchers have reconstructed 59 complete ABC transporters that include at least one NBD and one MSD, with the B. subtilis genome estimated to encode at least 78 ABC transporters in total (38 importers and 40 extruders) .

How do ABC transporter permease proteins function within the transport mechanism?

ABC transporter permease proteins like yesQ form the transmembrane channel component of ABC transporters. These proteins typically exhibit a conserved topology despite low sequence conservation. Type I ABC transporters generally contain 5-6 transmembrane helices per permease domain, while Type II transporters feature 10-12 helices . The permease domains dimerize with NBDs to form the minimal functional unit of an importer, with the SBP serving as the fifth component .

The transport mechanism involves conformational changes in the permease domains that provide alternating access from one side of the membrane to the other. This structural rearrangement allows for unidirectional substrate transport across the membrane. The specificity of transport is largely determined by the binding of substrate to the SBP and formation of the proper complex with the permease domains .

What molecular techniques are most effective for studying the function of yesQ in B. subtilis?

To study yesQ function, researchers should consider a multi-faceted approach:

  • Gene knockout studies: Deletion of the yesQ gene can reveal phenotypic changes that indicate its physiological role. This can be achieved through homologous recombination techniques specific to B. subtilis.

  • Recombinant expression systems: The yesQ gene can be cloned into expression vectors like pHT43, which has been successfully used for recombinant protein expression in B. subtilis . This approach allows for the production of wild-type or modified yesQ proteins with tags for purification and detection.

  • Transport assays: Development of specific assays to measure the transport of predicted substrates in wild-type versus yesQ-deleted strains can provide direct evidence of transport function.

  • Protein-protein interaction studies: Co-immunoprecipitation or bacterial two-hybrid systems can identify interactions between yesQ and other components of its ABC transporter complex.

The successful expression of recombinant proteins in B. subtilis can be confirmed using Western blotting with specific antibodies, as demonstrated in studies with other recombinant B. subtilis strains .

What are the most suitable methods for generating recombinant B. subtilis strains expressing modified yesQ proteins?

Generating recombinant B. subtilis strains expressing modified yesQ requires:

  • Selection of an appropriate expression vector: Shuttle vectors like pHT43 have been successfully used for recombinant protein expression in B. subtilis . These vectors typically contain:

    • A strong, inducible promoter (like the IPTG-inducible promoter)

    • A multiple cloning site for insertion of the target gene

    • Antibiotic resistance markers for selection

  • Transformation method: Electroporation has been shown to be effective for transforming plasmids into B. subtilis strains like WB800N . The protocol typically involves:

    • Growing B. subtilis to mid-log phase (OD600 = 0.5)

    • Washing cells to remove salts

    • Mixing with plasmid DNA

    • Applying an electrical pulse

    • Recovery in rich media before plating on selective media

  • Selection of transformants: Media containing appropriate antibiotics such as chloramphenicol (5 μg/mL) can be used to select for successful transformants .

  • Induction of protein expression: IPTG (0.1M) can be added when cultures reach mid-log phase to induce expression of the recombinant protein .

  • Verification of expression: Western blotting using specific antibodies against yesQ or attached tags can confirm successful expression .

How can researchers investigate the substrate specificity of the yesQ permease protein?

Investigating substrate specificity of yesQ requires a combination of computational and experimental approaches:

  • Sequence homology analysis: Compare yesQ with characterized ABC transporter permeases to predict potential substrate classes (metals, peptides, amino acids, sugars, etc.) .

  • Substrate uptake assays: Develop assays using radiolabeled or fluorescently labeled potential substrates to measure transport in wild-type versus yesQ-deleted strains.

  • Competition assays: Perform transport studies in the presence of potential competitive inhibitors to determine substrate binding characteristics.

  • Binding affinity measurements: Use purified components to measure binding affinities of different substrates to the transporter complex.

  • Growth phenotype screening: Test growth of yesQ-deficient strains on media with different sole nutrient sources to identify potential substrates.

The substrate recognition mechanism largely depends on the interaction between the substrate binding protein and the permease domain. This selectivity is crucial for bacteria to acquire essential nutrients from their environment while regulating the effects of potential toxicity .

What approaches can be used to investigate the role of yesQ in bacterial pathogenesis or survival?

To investigate the role of yesQ in bacterial survival or pathogenesis:

  • Comparative genomics: Compare the yesQ gene and its flanking regions across different Bacillus strains to identify conservation patterns.

  • Stress response studies: Subject wild-type and yesQ-deficient strains to various stressors (nutrient limitation, pH changes, osmotic stress) to identify conditions where yesQ provides a survival advantage.

  • Host-interaction models: If B. subtilis is used as a probiotic or vaccine delivery vehicle, study how yesQ affects colonization and persistence in appropriate animal models .

  • Transcriptional regulation analysis: Identify conditions that upregulate yesQ expression, which may indicate its role in specific stress responses.

  • Metabolomic profiling: Compare metabolite profiles between wild-type and yesQ-deficient strains to identify metabolic pathways affected by loss of this transporter.

Understanding the role of specific ABC transporters like yesQ in nutrient acquisition can provide insights into bacterial survival strategies and potential targets for antimicrobial development .

What are effective strategies for engineering B. subtilis strains with modified yesQ for enhanced substrate transport?

Engineering B. subtilis with modified yesQ may involve:

  • Site-directed mutagenesis: Introduce specific mutations in the yesQ gene to alter substrate specificity or transport efficiency. Focus on:

    • Residues in predicted substrate binding sites

    • Residues at interfaces with other transporter components

    • Conserved motifs in transmembrane domains

  • Domain swapping: Create chimeric proteins by swapping domains between yesQ and other permease proteins with known substrate specificity.

  • Promoter engineering: Replace the native yesQ promoter with stronger or inducible promoters to enhance expression levels.

  • Operon reconstruction: Similar to approaches used with riboflavin operons, reconstruct the entire ABC transporter operon containing yesQ under the control of a strong promoter to increase transporter abundance .

  • Co-expression strategies: Express yesQ along with its associated NBDs and SBPs to ensure proper complex formation and function.

Studies with recombinant B. subtilis have demonstrated successful protein expression using plasmid vectors with strong promoters and appropriate selection markers . These principles can be applied to yesQ engineering.

How can researchers monitor and quantify the expression and activity of recombinant yesQ in B. subtilis?

Monitoring expression and activity of recombinant yesQ can be accomplished through:

  • Protein quantification methods:

    • Western blotting using antibodies against yesQ or attached tags (His, FLAG, etc.)

    • Fluorescence-based methods if yesQ is fused to fluorescent proteins

    • Mass spectrometry for absolute quantification

  • Localization studies:

    • Membrane fractionation to confirm proper membrane localization

    • Immunofluorescence microscopy with fluorescently labeled antibodies

    • Electron microscopy with immunogold labeling

  • Functional assays:

    • Transport assays using potential substrates

    • Growth complementation in yesQ-deficient strains

    • ATP hydrolysis assays to measure energy coupling

  • Real-time monitoring:

    • Development of biosensors that detect substrate transport

    • Real-time PCR to monitor transcriptional regulation of yesQ under different conditions

Validation of proper expression and membrane insertion is crucial when working with membrane proteins like yesQ, as misfolding or aggregation can occur during overexpression.

What are common challenges in working with membrane proteins like yesQ and how can they be addressed?

Working with membrane proteins presents several challenges:

  • Expression challenges:

    • Issue: Toxicity due to overexpression

    • Solution: Use tightly regulated inducible promoters and optimize induction conditions (IPTG concentration, temperature, time)

  • Protein solubilization:

    • Issue: Difficult extraction from membranes

    • Solution: Screen detergents for optimal solubilization; consider membrane scaffold proteins for nanodiscs

  • Purification difficulties:

    • Issue: Maintaining stability and function during purification

    • Solution: Develop gentle purification protocols; consider on-column folding strategies

  • Functional analysis:

    • Issue: Developing reliable transport assays

    • Solution: Use proteoliposomes or whole-cell assays with fluorescent substrates

  • Structural characterization:

    • Issue: Obtaining structural information

    • Solution: Consider cryo-EM or X-ray crystallography approaches optimized for membrane proteins

The isolation and characterization of membrane proteins often require specialized techniques beyond those used for soluble proteins, making this a technically challenging but important area of research.

How can researchers troubleshoot issues with recombinant yesQ expression in B. subtilis?

When troubleshooting recombinant yesQ expression:

  • No or low expression:

    • Check plasmid stability and maintenance in B. subtilis

    • Optimize codon usage for B. subtilis

    • Verify promoter functionality with a reporter gene

    • Test different growth and induction conditions (media composition, IPTG concentration, temperature)

  • Protein misfolding:

    • Lower expression temperature to slow folding

    • Co-express with chaperones

    • Include stabilizing ligands during expression

  • Toxicity issues:

    • Use tightly controlled inducible systems

    • Test different B. subtilis host strains (e.g., WB800N which lacks proteases)

    • Consider integration into the chromosome rather than plasmid-based expression

  • Functional issues:

    • Co-express with other components of the ABC transporter complex

    • Verify proper membrane integration using fractionation methods

    • Include appropriate tags that don't interfere with function

  • Degradation problems:

    • Use protease-deficient strains like B. subtilis WB800N

    • Optimize harvest time to catch peak expression

    • Include protease inhibitors during extraction

Successful expression of recombinant proteins in B. subtilis has been achieved using appropriate vectors and optimized conditions, providing a foundation for yesQ expression strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.