Recombinant Bacillus subtilis Probable ABC transporter permease protein yqgH (yqgH)

Shipped with Ice Packs
In Stock

Description

Domain Architecture

YqgH belongs to the transmembrane domain (TMD) of ABC transporters, which typically form α-helical bundles that undergo conformational changes to facilitate substrate movement . Computational modeling predicts YqgH adopts a 309-amino-acid structure with six transmembrane helices, consistent with permease subunits .

Mechanistic Role

  • Substrate Transport: ABC transporters like YqgH utilize ATP hydrolysis to power substrate translocation. YqgH likely operates as part of a heterodimer, as observed in the related B. subtilis YheI/YheH system, which transports antibiotics such as tetracycline and erythromycin .

  • Drug Resistance: Overexpression of yqgH and associated operon genes is induced by sub-inhibitory antibiotic concentrations, suggesting a role in multidrug efflux .

Recombinant Production and Purification

Recombinant YqgH is produced in E. coli or cell-free systems, often fused with hexahistidine tags for affinity purification . Key specifications include:

ParameterDetails
Host SystemE. coli or cell-free expression
Purity≥85% (SDS-PAGE)
Molecular Weight~34 kDa (calculated from 309-amino-acid sequence)
TagN-terminal His tag
StorageLyophilized powder in Tris/PBS buffer with trehalose (pH 8.0)

Gene Cluster

  • Operon Association: yqgH (locus tag: BSU24980) is co-transcribed with yqgI (BSU24970), encoding another permease subunit, forming a putative ABC transporter complex .

  • Homologs: Orthologs include pstC (phosphate transporter permease) in Rhizobium loti and Shigella flexneri, highlighting functional diversification .

Antibiotic Resistance Studies

  • YqgH homologs (e.g., YheH) are essential for efflux of structurally diverse antibiotics, providing a model for studying multidrug resistance mechanisms .

  • Transcriptional upregulation of yqgH under antibiotic stress underscores its clinical relevance .

Biotechnological Platforms

  • B. subtilis is a preferred host for recombinant YqgH due to its GRAS status, endotoxin-free production, and high protein yield (e.g., 10–200 mg/L in optimized systems) .

  • Dual-promoter systems (e.g., P43 and Pgrac) enhance expression efficiency .

Comparative Analysis of ABC Transporters in B. subtilis

FeatureYqgHYheI/YheHRv1819c (Mycobacterium)
Substrate SpecificityPutative multidrug effluxTetracycline, erythromycin Cobalamin, bleomycin
StructurePredicted 6-TMD helix bundle Heterodimeric TMD-NBD complex ABC exporter fold with hydrophilic cavity
Expression HostE. coli, cell-free systems E. coli Mycobacterium smegmatis

Future Directions

  • Structural Validation: Cryo-EM studies are needed to resolve YqgH’s conformational dynamics during substrate transport .

  • Industrial Optimization: Leveraging B. subtilis’s secretory pathways (e.g., sec or tat) could improve YqgH yield for large-scale applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yqgH; yzmC; BSU24980; Probable ABC transporter permease protein YqgH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yqgH
Target Protein Sequence
MINNRENMSVSERLISSRQNRQLDEVRGRMIVTACALIMIAASVAITIFLGVKGLQSFLV NGVSPIEFLTSLNWNPTDSDPKYGVLPFIFGSFAVTILSALIAAPLGIAGAIFMTEIAPN WGKKVLQPVIELLVGIPSVVYGFIGLTVLVPFIAQFKSSGTGHSLLAGTIVLSVMILPTI TSISADAMASLPKSLREGSYALGATRWQTIRKVLVPAAFPTLMTAVVLGMARAFGEALAV QMVIGNTRVLPESPFDTAGTLTTIITLNMGHTTYGSVENNTLWSMGLVLLVMSFLFILLI RYLSSRRKV
Uniprot No.

Target Background

Function
This protein is part of the binding-protein-dependent transport system YqgGHIJK. It is likely responsible for substrate translocation across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the YqgH protein in Bacillus subtilis and how is it classified within ABC transporter systems?

YqgH is classified as a probable ABC transporter permease protein in Bacillus subtilis. ABC (ATP-Binding Cassette) transporters constitute one of the largest families of membrane proteins across most organisms, including bacteria . In B. subtilis specifically, ABC transporters play diverse roles in nutrient acquisition, drug efflux, and various physiological processes.

The classification of YqgH as a "probable" permease component indicates that while bioinformatic analysis strongly suggests this function, comprehensive experimental validation is still developing. ABC transporter systems typically consist of transmembrane domains (TMDs) that form the substrate translocation pathway (where permease proteins like YqgH function) and nucleotide-binding domains (NBDs) that bind and hydrolyze ATP to drive transport . YqgH likely forms part of a multi-component transport system involved in membrane translocation of specific substrates.

How does the genomic context of yqgH compare with other ABC transporter genes in B. subtilis?

The B. subtilis genome contains numerous ABC transporter systems distributed throughout its chromosome. Microarray-based comparative genomic hybridization (M-CGH) analyses have revealed considerable genomic diversity among B. subtilis strains, including variability in genes encoding carbohydrate and amino acid transport systems .

Within this context, the yqgH gene is part of the genomic diversity observed across different B. subtilis strains. ABC transporters in B. subtilis often exist in operons where genes encoding the permease components (like yqgH) are located adjacent to genes encoding the ATP-binding proteins and substrate-binding proteins. Variability in these transport genes contributes to the metabolic diversity observed among B. subtilis strains, potentially enabling them to thrive in different ecological niches .

What expression patterns does yqgH exhibit under different growth conditions?

While specific expression data for yqgH is not comprehensively documented in the provided search results, we can infer patterns based on knowledge of ABC transporters in B. subtilis. Expression of ABC transporters often responds to environmental conditions and substrate availability.

B. subtilis exhibits remarkable adaptability to diverse environments, from soil to the gastrointestinal tracts of animals . This adaptability is reflected in the differential expression of transport systems under varying growth conditions. Like other membrane transport systems in B. subtilis, yqgH expression likely varies in response to specific environmental cues, nutrient availability, or stress conditions. Expression may also be influenced by cellular developmental stages such as competence development or biofilm formation, both well-characterized phenomena in B. subtilis .

What are the most effective methods for producing recombinant YqgH protein for structural and functional studies?

Producing recombinant membrane proteins like YqgH presents significant challenges for structural and functional studies. Based on approaches used for other ABC transporters, several strategies can be recommended:

Expression System Optimization:

  • Test multiple expression systems including E. coli, B. subtilis itself, and eukaryotic systems

  • Evaluate different promoter strengths and induction conditions

  • Consider using orthologues from different Bacillus species, as protein stability can vary significantly between species

Protein Extraction and Purification:

  • Optimize detergent solubilization conditions critical for membrane protein isolation

  • Implement affinity tags for purification while ensuring they don't interfere with function

  • Use size exclusion chromatography for final purification steps

Table 1: Recommended Detergents for YqgH Solubilization

DetergentCritical Micelle ConcentrationAdvantagesLimitations
DDM0.17 mMMild, preserves functionLarge micelles
LMNG0.01 mMEnhanced stabilityExpensive
Digitonin~0.5 mMNative-like environmentNatural product variability
SMA copolymerN/AMaintains lipid environmentpH restrictions

Researchers should perform small-scale expression trials before scaling up, and consider stability-enhancing approaches such as co-expression with partner proteins or using thermostabilizing mutations .

How can we determine the specific substrates transported by the YqgH permease system?

Identifying substrates for "orphan" transporters remains one of the major challenges in ABC transporter research . For YqgH, a comprehensive approach combining multiple techniques is recommended:

  • Genetic Approaches:

    • Generate yqgH deletion mutants and assess growth phenotypes on different substrates

    • Perform suppressor mutation analysis to identify functional relationships

    • Utilize transposon mutagenesis libraries to identify synthetic lethal interactions

  • Biochemical Approaches:

    • Develop in vitro transport assays using purified protein reconstituted in liposomes

    • Perform substrate-binding assays using thermal shift analysis or isothermal titration calorimetry

    • Apply metabolomics to identify accumulated compounds in deletion mutants

  • Computational Approaches:

    • Conduct sequence and structural homology analysis with characterized ABC transporters

    • Perform molecular docking studies to predict potential substrates

    • Apply machine learning algorithms trained on known ABC transporter-substrate pairs

The integration of phenotypic characterization of knockout strains, together with direct biochemical assessment of transport activity, provides the most robust approach to substrate identification .

What potential role does YqgH play in competence development in B. subtilis?

Based on research on other proteins in B. subtilis, YqgH may have a role in competence development. The YqjG protein, another membrane protein in B. subtilis, has been demonstrated to be required for genetic competence development . Considering that ABC transporters can influence membrane composition and protein localization, YqgH might similarly impact competence through several potential mechanisms:

  • Membrane Composition Maintenance:

    • YqgH may transport substrates necessary for maintaining proper membrane fluidity or composition required during competence

    • This function would be particularly important as B. subtilis undergoes significant physiological changes during competence development

  • DNA Transport Component:

    • While the ComEC protein is the primary DNA channel during transformation, YqgH could potentially function as an accessory component facilitating DNA uptake

    • It may transport molecules that signal or regulate the competence state

  • Competence Signal Processing:

    • B. subtilis uses the ComPQX system for quorum sensing during competence development

    • YqgH might transport signals related to this system or influence signal molecule concentration

The investigation of YqgH's role in competence could follow similar methodologies to those used for characterizing YqjG, including membrane proteome analysis of cells devoid of YqgH and assessment of transformation efficiency in knockout strains .

What are the most effective strategies for generating and validating yqgH knockout mutants in B. subtilis?

Creating and properly validating yqgH knockout mutants requires careful methodology to ensure clean genetic manipulation without polar effects on adjacent genes:

  • Knockout Construction Approaches:

    • Precise allelic replacement using homologous recombination

    • CRISPR-Cas9 gene editing for scarless deletions

    • Insertion of antibiotic resistance cassettes with strong terminators to prevent read-through effects

  • Validation Strategy:

    Table 2: Comprehensive Validation Protocol for yqgH Knockout Mutants

    Validation LevelMethodPurpose
    GenomicPCR verification with flanking primersConfirm desired deletion
    GenomicWhole genome sequencingRule out secondary mutations
    TranscriptomicRT-PCR of flanking genesVerify absence of polar effects
    ProteomicWestern blotConfirm protein absence
    FunctionalComplementation studiesVerify phenotype causality
    FunctionalHeterologous expressionRescue functionality
  • Phenotypic Characterization:

    • Growth kinetics in diverse media compositions

    • Biofilm formation assessment

    • Competence development measurement

    • Membrane integrity testing

    • Stress response evaluation

The most robust approach combines multiple knockouts (single, double, and complemented strains) with comprehensive phenotypic characterization to delineate YqgH function within the cellular context .

What structural characterization methods are most suitable for elucidating YqgH protein topology and functional domains?

Membrane proteins like YqgH present unique challenges for structural characterization. A multi-technique approach is recommended:

  • Computational Prediction:

    • Topology prediction algorithms (TMHMM, Phobius)

    • Homology modeling based on solved ABC transporter structures

    • Molecular dynamics simulations to assess conformational dynamics

  • Experimental Structure Determination:

    • X-ray crystallography (requiring extensive optimization of purification and crystallization conditions)

    • Cryo-electron microscopy (increasingly powerful for membrane proteins)

    • NMR spectroscopy for specific domains or segments

  • Topology Mapping:

    • Cysteine scanning mutagenesis coupled with accessibility assays

    • EPR spectroscopy with site-directed spin labeling to measure distances and probe accessibility

    • Limited proteolysis coupled with mass spectrometry

    • X-ray radiolytic footprinting combined with mass spectrometry (XF-MS) to identify structural waters and conformational changes

  • Functional Domain Characterization:

    • Chimeric protein construction with other characterized permeases

    • Site-directed mutagenesis of conserved residues

    • Suppressor mutation analysis

The integration of computational predictions with experimental validation provides the most complete picture of YqgH structure. Single-molecule approaches and single liposome techniques offer promising avenues for characterizing transport dynamics .

How can researchers effectively analyze interactions between YqgH and other components of its ABC transporter complex?

Understanding protein-protein interactions within ABC transporter complexes is crucial for elucidating their function. Several complementary approaches can be applied to study YqgH interactions:

  • In vivo Interaction Studies:

    • Bacterial two-hybrid or split-GFP assays

    • Co-immunoprecipitation with tagged components

    • FRET/BRET analyses to detect proximity in living cells

    • Chemical crosslinking followed by mass spectrometry

  • Biochemical Characterization:

    • Co-purification of complex components

    • Blue native PAGE to preserve native complexes

    • Surface plasmon resonance or biolayer interferometry for binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

  • Structural Studies of Complexes:

    • Cryo-EM of the assembled transporter complex

    • X-ray crystallography of co-purified components

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Functional Validation:

    • Reconstitution of purified components in liposomes

    • ATP hydrolysis assays to measure coupled activity

    • Transport assays with reconstituted complexes

Table 3: Advantages and Limitations of YqgH Interaction Analysis Methods

MethodAdvantagesLimitationsBest Application
Bacterial two-hybridIn vivo relevance, high-throughputPotential false positivesInitial screening
Co-immunoprecipitationNative complexes, endogenous levelsTransient interactions may be missedVerification of stable interactions
Crosslinking-MSCaptures transient interactionsComplex data analysisMapping interaction interfaces
Cryo-EMStructural visualization of complexRequires homogeneous sampleComplete structural analysis
ReconstitutionFunctional validationTechnically challengingConfirming physiological relevance

For ABC transporters, it's particularly important to study interactions in different nucleotide-bound states (ATP, ADP, nucleotide-free) as these can dramatically alter conformation and interaction dynamics .

How can researchers distinguish between direct and indirect effects when analyzing yqgH deletion phenotypes?

Distinguishing direct from indirect effects of yqgH deletion requires a comprehensive experimental design:

  • Genetic Complementation Analysis:

    • Express wildtype yqgH from an inducible promoter in the deletion strain

    • Create point mutations in functional domains to identify critical residues

    • Use orthologous genes from related species for cross-complementation

  • Temporal Control Strategies:

    • Implement inducible/repressible expression systems

    • Use degradation tag systems for rapid protein depletion

    • Apply optogenetic control of protein activity where feasible

  • Systems Biology Approaches:

    • Transcriptomics to identify affected pathways

    • Proteomics to detect changes in membrane protein composition

    • Metabolomics to identify accumulated or depleted metabolites

    • Network analysis to distinguish primary from secondary effects

  • Chemical Genetic Approaches:

    • Use specific inhibitors of related processes

    • Chemical complementation with transported substrates

    • Suppressor screens to identify functional relationships

The most robust approach involves creating multiple mutant strains with different types of mutations (null, hypomorphic, conditional) and comparing their phenotypic profiles across diverse conditions .

What are the most informative assays for measuring YqgH-dependent transport activity?

Measuring transport activity of membrane proteins like YqgH requires specialized techniques:

  • In Vivo Transport Assays:

    • Substrate accumulation in whole cells (using radiolabeled or fluorescent substrates)

    • Growth-based assays on media where YqgH function is required

    • Membrane potential measurements if transport is electrogenic

    • pH-sensitive fluorescent proteins if transport involves proton coupling

  • In Vitro Reconstituted Systems:

    • Purified protein reconstitution in proteoliposomes

    • Substrate uptake/efflux measurements with fluorescent substrates

    • Counterflow assays to determine substrate specificity

    • Patch clamp electrophysiology for electrogenic transporters

  • ATP Hydrolysis Coupling:

    • ATPase activity measurements in membrane vesicles

    • Coupling ratio determination between ATP hydrolysis and transport

    • Vanadate-sensitive ATPase activity to confirm ABC transporter function

Table 4: Transport Activity Assay Comparison for YqgH Functional Analysis

Assay TypeMeasurementAdvantagesTechnical Considerations
Whole cell uptakeSubstrate accumulationPhysiological contextBackground transport
Proteoliposome transportDirect substrate movementDefined componentsReconstitution efficiency
ATPase activityATP hydrolysis rateQuantitativeCoupling to transport
CounterflowExchange specificitySubstrate spectrumLoading efficiency
ElectrophysiologyCurrent/potential changesReal-time kineticsTechnical complexity

For comprehensive characterization, combining multiple assays provides the most complete functional profile of YqgH-mediated transport activity .

How does the study of yqgH contribute to our understanding of horizontal gene transfer mechanisms in B. subtilis?

B. subtilis is naturally competent for DNA transformation, a process involving the uptake and integration of extracellular DNA into its genome . The potential role of yqgH in this process can provide insights into horizontal gene transfer (HGT) mechanisms:

  • Competence Machinery Interactions:

    • YqgH may interact with components of the DNA uptake machinery

    • It could potentially modulate membrane properties that affect DNA binding or uptake

    • Permease activity might influence signaling molecules that regulate competence

  • Phage Resistance Relationships:

    • ABC transporters can mediate resistance to bacteriophages

    • B. subtilis genomic diversity includes phage-mediated horizontal gene transfer (accounting for up to 16% of HGT regions)

    • YqgH might influence susceptibility to phage infection or DNA integration

  • Mobile Genetic Element Association:

    • Analyze the genomic context of yqgH for signs of horizontal acquisition

    • Evaluate yqgH presence/absence patterns across B. subtilis strains

    • Determine if yqgH itself shows evidence of horizontal transfer

  • Experimental Approaches:

    • Measure transformation frequencies in yqgH mutants

    • Assess integration of specific DNA sequences in the presence/absence of YqgH

    • Examine interactions with the ComPQX system, which shows strain-specific variability

Understanding yqgH's role in these processes contributes to the broader knowledge of how bacterial membrane transporters influence genome plasticity and evolution through horizontal gene transfer mechanisms .

How conserved is yqgH across different Bacillus species and what does this suggest about its functional importance?

The conservation pattern of yqgH across Bacillus species provides valuable insights into its evolutionary significance and functional importance:

  • Phylogenetic Distribution Analysis:

    • Comparative genomic analysis across the Bacillus genus reveals the distribution pattern of yqgH homologs

    • M-CGH studies have shown considerable genome diversity among B. subtilis strains, with variability in transport-related genes

    • The presence/absence pattern across diverse ecological niches can indicate environmental adaptation roles

  • Sequence Conservation Assessment:

    Table 5: Representative Conservation Analysis of YqgH Across Bacillus Species

    SpeciesSequence Identity (%)Conservation of Functional DomainsEcological Niche
    B. subtilis100 (reference)CompleteSoil, plant roots, GI tract
    B. licheniformis~75-85*High in TMDs, variable in substrate bindingSoil, feathers
    B. amyloliquefaciens~70-80*Conserved ATP-binding, variable specificity loopPlant-associated
    B. cereus group~40-60*Divergent substrate binding domainsInsect pathogen, food
    B. anthracis~40-55*Major differences in substrate recognitionMammalian pathogen

    *Note: Exact values would depend on specific strain comparisons

  • Synteny and Operon Structure:

    • Analysis of gene neighborhood conservation across species

    • Identification of co-evolved gene clusters suggesting functional relationships

    • Comparison of regulatory elements controlling yqgH expression

  • Selection Pressure Analysis:

    • Calculation of dN/dS ratios to determine selective pressure

    • Identification of positively selected residues indicating adaptive evolution

    • Analysis of substrate-binding domains for signs of diversifying selection

The pattern of conservation typically reveals that core functional domains involved in ATP binding and hydrolysis are highly conserved, while substrate-binding domains show greater variability, reflecting adaptation to different ecological niches and substrate requirements .

What emerging technologies hold the most promise for elucidating the complete functional profile of YqgH?

Several cutting-edge technologies are poised to revolutionize our understanding of ABC transporters like YqgH:

  • Structural Biology Advances:

    • Cryo-electron microscopy at subnanometer resolution allowing visualization of conformational changes during transport cycles

    • Integrated structural approaches combining crystallography, EPR, and molecular dynamics simulations

    • Time-resolved structural methods to capture transport intermediates

  • Single-Molecule Techniques:

    • Single-molecule FRET to observe conformational dynamics in real-time

    • Single-molecule transport assays in liposomes to eliminate ensemble averaging

    • Force spectroscopy to measure substrate interactions and conformational changes

  • Advanced Genetic Tools:

    • CRISPR interference for precise temporal control of gene expression

    • Deep mutational scanning to comprehensively map structure-function relationships

    • In vivo biochemistry using genetically encoded sensors for transport activity

  • Systems Biology Integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to position YqgH in cellular transport networks

    • Machine learning to predict substrate specificity from sequence and structural features

These technologies promise to move beyond static snapshots of transporter function toward dynamic understanding of how YqgH operates within the cellular context, potentially revealing unexpected functions and regulatory mechanisms .

How might research on YqgH contribute to understanding bacterial adaptation to diverse environments?

B. subtilis exhibits remarkable adaptability to diverse environments, from soil to animal gastrointestinal tracts . Research on YqgH can provide insights into this adaptability:

  • Ecological Niche Adaptation:

    • Comparative studies of yqgH variants from B. subtilis strains isolated from different environments

    • Assessment of transport capabilities under different environmental conditions

    • Correlation between yqgH sequence variants and habitat preferences

  • Stress Response Connection:

    • Analysis of yqgH expression under various stress conditions

    • Determination of YqgH's role in exporting toxic compounds or importing protective molecules

    • Investigation of potential roles in biofilm formation, which is a key adaptation mechanism

  • Community Interactions:

    • Examination of YqgH's potential role in microbial community interactions

    • Assessment of competitive fitness with and without functional YqgH

    • Investigation of potential roles in signaling molecule transport that might influence quorum sensing

  • Experimental Evolution Approaches:

    • Laboratory evolution experiments under selective pressures

    • Tracking mutations in yqgH during adaptation to challenging environments

    • Engineering YqgH variants with altered substrate specificity to test adaptation hypotheses

Understanding YqgH's contribution to B. subtilis adaptability may reveal broader principles about how membrane transporters facilitate bacterial survival across diverse and changing environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.