Recombinant Bacillus subtilis Probable ABC transporter permease protein yurN (yurN)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis ABC Transporter Permease Protein yurN

Recombinant Bacillus subtilis Probable ABC transporter permease protein yurN (UniProt ID: O32155) is a membrane-associated protein expressed in E. coli for research purposes. This component belongs to the ATP-binding cassette (ABC) transporter family, which facilitates substrate transport across cellular membranes via ATP hydrolysis . The yurN gene (BSU32590) encodes a full-length permease (1–292 amino acids) fused to an N-terminal histidine tag for purification .

Studying Transporter Interactions

  • Co-purification Assays: His-tagged yurN enables affinity chromatography to identify interacting ATP-binding proteins (e.g., YheH) .

  • ATPase Activity: Mutagenesis of Walker-A motifs (e.g., Lys → Ala) can confirm ATP-dependent transport mechanisms .

Drug Resistance Models

  • Antibiotic Induction: Expression of ABC transporters like yurN may be upregulated under antibiotic stress, as observed for YtrBCDEF .

  • Substrate Profiling: Membrane vesicle assays can test yurN’s role in exporting structurally diverse drugs (e.g., tetracyclines, macrolides) .

Production and Optimization Strategies

ParameterOptimized Protocol
Expression SystemE. coli BL21(DE3) with T7 promoter induction for high-yield production .
PurificationNi-NTA affinity chromatography (His-tag), followed by size-exclusion chromatography.
StabilityLyophilized powder stored at -20°C/-80°C; avoid repeated freeze-thaw cycles .

Comparative Analysis of B. subtilis ABC Transporters

TransporterSubunitsProposed FunctionKey References
yurNPermease (yurN)Substrate export (inferred)
YheI/YheHATP-binding (YheI)Multidrug efflux, antibiotic resistance
YtrBCDEFATP-binding (YtrB/E), Permease (YtrC/D)Acetoin utilization, cell wall regulation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
yurN; BSU32590; Probable ABC transporter permease protein YurN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yurN
Target Protein Sequence
MVNQNKIIPYLFLVPALVFLLFVYIPIFENVFLSLFQWSSFSPEKTFIGLKNYVELFHDP VFYQALTNNVLYAVISIVCQVFGGLILAAVLEDKLVRKWSPFFRTVFFLPVVISMTVIAL LFDFIYNPETGLLNQLLQAIGLDQLTRAWLGDDSTAMLSVIFVSQWQSVGYIAMLYIVSI QKIPDELYEAARLDGAGKIQQFFHITVPQTKEMSFVAVVMTLTGAFTVFNEPYILTGGGP GKASEVLSTFLYKSAFTKDMMGYASAIATVVLIITLALSLMQMKFFKTGKEE
Uniprot No.

Target Background

Function

Likely a component of the YurMNO binding-protein-dependent transport system. It is believed to facilitate substrate translocation across the membrane.

Database Links
Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How do ABC transporters like yurN function in B. subtilis?

ABC transporters in B. subtilis operate through a coordinated mechanism involving multiple protein components:

  • Structural Organization: ABC transporters typically consist of four core modules: two transmembrane domains (TMDs) like yurN that form the substrate translocation pathway, and two nucleotide-binding domains (NBDs) that bind and hydrolyze ATP to power transport .

  • Transport Mechanism: Upon ATP binding and hydrolysis by the NBDs, conformational changes occur in the TMDs, facilitating substrate movement across the membrane. This process involves alternating access of the substrate-binding site from one side of the membrane to the other .

  • Uptake Systems: Import systems in B. subtilis (like potentially yurN) typically include an additional extracellular substrate-binding protein that captures the substrate and delivers it to the permease component .

The functional versatility of these transporters allows them to handle diverse substrates ranging from simple sugars to complex organic molecules, contributing to various cellular processes including nutrient acquisition and detoxification .

What are the optimal conditions for heterologous expression of recombinant B. subtilis yurN protein?

Based on established protocols for recombinant B. subtilis membrane proteins, the following expression system has been demonstrated to be effective:

Expression System Parameters:

ParameterRecommended ConditionRationale
Host SystemE. coliMost commonly used for yurN expression due to high yield and ease of genetic manipulation
Expression VectorpET-based with His-tagFacilitates purification and detection
InductionIPTG (0.1-1.0 mM)Controlled induction of protein expression
Temperature18-25°C post-inductionLower temperatures reduce inclusion body formation for membrane proteins
Duration4-16 hoursOptimizes protein yield while maintaining proper folding
MediaLB or TB with appropriate antibioticsSupports robust cell growth

Methodological Considerations:

For membrane proteins like yurN, expression optimization should include:

  • Screening multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3)) specifically designed for membrane protein expression

  • Utilizing specialized detergents during lysis and purification (e.g., n-dodecyl-β-D-maltoside or CHAPS)

  • Including membrane-stabilizing agents like glycerol (5-10%) in buffers

  • Considering fusion with stability-enhancing partners like MBP (maltose-binding protein) if expression yields are insufficient

What purification strategies are most effective for recombinant yurN protein?

A multi-step purification protocol is recommended:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged constructs

    • Buffer composition: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 0.1-1% detergent, 5-10% glycerol

    • Sequential washes with increasing imidazole (10-40 mM)

    • Elution with 250-300 mM imidazole

  • Secondary Purification: Size exclusion chromatography (SEC)

    • Buffer: 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 0.03-0.05% detergent, 5% glycerol

    • Column: Superdex 200 or equivalent

  • Quality Assessment:

    • SDS-PAGE analysis (>90% purity achievable)

    • Western blotting using anti-His antibodies for verification

    • Circular dichroism to confirm secondary structure integrity

For functional studies, reconstitution into proteoliposomes or nanodiscs may be necessary to maintain native conformation and activity .

How can the transport activity of recombinant yurN be measured in experimental systems?

Several complementary approaches can be employed to assess the transport function of yurN:

  • In Vitro Transport Assays:

    • Reconstitute purified yurN (with its cognate NBD and substrate-binding proteins) into proteoliposomes

    • Load proteoliposomes with fluorescent substrates or radiolabeled compounds

    • Measure substrate accumulation or efflux over time

    • Include ATP vs. non-hydrolyzable ATP analogs to confirm ATP-dependence

  • Whole-Cell Transport Assays:

    • Generate yurN knockout strains of B. subtilis

    • Complement with wild-type or mutant yurN constructs

    • Measure uptake of radiolabeled or fluorescent substrates

    • Compare transport kinetics between wild-type and mutant strains

  • ATP Hydrolysis Assays:

    • Measure ATP hydrolysis rates using the malachite green phosphate assay

    • Compare basal and substrate-stimulated ATPase activity

    • Determine Km and Vmax values for different potential substrates

  • Substrate Specificity Profiling:

    • Based on the annotation as a potential fructose-amino acid permease, test various fructose-amino acid compounds as substrates

    • Employ competition assays with known substrates to identify novel transported molecules

What are the current hypotheses regarding the physiological role of yurN in B. subtilis?

The physiological function of yurN remains under investigation, but several hypotheses have emerged:

  • Nutrient Acquisition: As part of the fructose-amino acid transport system (suggested by its alternative name frlN), yurN may contribute to the uptake of nitrogen-containing carbon sources, particularly during nutrient limitation .

  • Specialized Transport Functions: Like other ABC transporters in B. subtilis, yurN might be involved in the import of specific signaling molecules or precursors required for cellular differentiation processes such as sporulation or biofilm formation .

  • Stress Response: Some ABC transporters in B. subtilis are activated during environmental stress conditions. yurN might participate in the detoxification or adaptation processes during oxidative stress or DNA damage responses .

  • Antibiotic Resistance: By analogy with other characterized ABC transporters in B. subtilis like BceAB, yurN might contribute to intrinsic resistance against certain antimicrobial compounds through transport or target protection mechanisms .

Research using transcriptional profiling under different growth conditions and phenotypic characterization of knockout mutants would help clarify the specific physiological roles.

How can site-directed mutagenesis be applied to study structure-function relationships in yurN?

Site-directed mutagenesis provides powerful insights into structure-function relationships in ABC transporter permeases like yurN. The following systematic approach is recommended:

  • Target Selection Based on Sequence Analysis:

    • Conserved motifs in transmembrane regions (identified through multiple sequence alignments)

    • Charged residues within predicted transmembrane segments

    • Residues at the predicted interface with nucleotide-binding domains

    • Putative substrate-binding pocket residues

  • Mutation Design Strategy:

    • Conservative substitutions (e.g., D→E, K→R) to test charge requirements

    • Non-conservative substitutions (e.g., D→A, K→A) to eliminate side chain properties

    • Cysteine scanning mutagenesis for accessibility studies

    • Introduction of reporter groups for conformational studies

  • Functional Characterization of Mutants:

    • Transport assays comparing wild-type and mutant proteins

    • ATP hydrolysis measurements to distinguish between defects in substrate binding versus translocation

    • Thermostability assays to identify mutations affecting protein folding

    • Chemical cross-linking to assess changes in protein-protein interactions within the transporter complex

  • Structural Validation:

    • Homology modeling based on related ABC transporters with known crystal structures

    • Validation of key residue functions through suppressor mutation analysis

    • Integration with data from other ABC transporters to build a comprehensive mechanistic model

What is known about the regulation of yurN expression in B. subtilis?

While specific regulatory mechanisms for yurN remain to be fully characterized, insights can be drawn from studies on related ABC transporters in B. subtilis:

  • Operon Structure and Organization:

    • yurN is likely part of an operon that includes genes encoding other components of the ABC transporter (nucleotide-binding domain and substrate-binding protein)

    • The complete transporter may be encoded by the yurN-containing operon, functioning as a coordinated unit

  • Regulatory Mechanisms:

    • Expression might be controlled by substrate-responsive transcriptional regulators

    • Potential regulation by global stress response systems (e.g., σB-dependent regulation during environmental stress)

    • Possible control by two-component regulatory systems that sense environmental signals

  • Experimental Approaches to Study Regulation:

    • Promoter-reporter fusions (e.g., lacZ) to monitor expression under different conditions

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the promoter region

    • RNA-seq analysis comparing expression profiles under different growth conditions or stress exposures

    • Genetic screens to identify regulators affecting yurN expression

For comprehensive characterization, researchers should analyze the promoter region of the yurN-containing operon for regulatory elements and assess expression responses to various nutrient conditions and stressors.

How does yurN interact with other components of the ABC transporter complex?

The functional ABC transporter complex incorporating yurN likely involves multiple protein-protein interactions:

  • Core Complex Assembly:

    • yurN (permease/TMD) interacts with a nucleotide-binding domain protein (NBD)

    • In some ABC transporters, two identical permease subunits form homodimers, while in others, distinct permease proteins form heterodimers

    • The NBD provides the energy for transport through ATP binding and hydrolysis

  • Experimental Methods to Study Interactions:

    • Co-immunoprecipitation of tagged components

    • Bacterial two-hybrid assays to confirm direct interactions

    • Cross-linking followed by mass spectrometry to identify interaction interfaces

    • Blue native PAGE to analyze intact complexes

    • FRET-based approaches to study dynamics of interactions in live cells

  • Interaction Dynamics During Transport Cycle:

    • Conformational changes in the NBD upon ATP binding and hydrolysis propagate to the TMD

    • These changes alter the accessibility of the substrate-binding site, facilitating transport

    • The ATP-binding cassette undergoes significant rearrangement during the transport cycle

  • Associated Proteins:

    • Substrate-binding proteins that capture and deliver substrates to the transporter

    • Regulatory proteins that modulate transport activity

    • Accessory proteins that assist in membrane insertion or complex assembly

Understanding these interactions is crucial for developing a complete mechanistic model of transport and for designing strategies to modulate transporter function.

How does yurN and related ABC transporters contribute to B. subtilis biofilm formation and sporulation?

ABC transporters play diverse roles in B. subtilis differentiation processes:

  • Biofilm Formation:

    • Some ABC transporters export extracellular matrix components essential for biofilm structure

    • Transporters may regulate the availability of signaling molecules that trigger biofilm development

    • The DNA damage response in B. subtilis influences biofilm formation, with possible involvement of specific transporters in stress-response integration

    • ABC transporters might contribute to the heterogeneity observed in biofilm subpopulations

  • Sporulation Process:

    • ABC transporters can support nutrient acquisition during the early stages of sporulation

    • Some transporters may export peptide signals involved in sporulation initiation

    • Specific ABC transporters are differentially expressed during various stages of sporulation

    • Transporters like yurN might participate in mother cell-forespore communication during asymmetric division

  • Experimental Evidence in Related Systems:

    • Knockout studies of various ABC transporters reveal alterations in biofilm architecture

    • Transcriptional profiling shows differential expression of transporters during developmental transitions

    • Fluorescence microscopy demonstrates spatial localization of ABC transporters during differentiation processes

While direct evidence for yurN's specific role in these processes is limited, its potential contributions warrant investigation using genetic knockout studies and expression analysis during relevant developmental transitions.

What roles do ABC transporters like yurN play in B. subtilis antibiotic resistance mechanisms?

ABC transporters contribute to antimicrobial resistance in B. subtilis through multiple mechanisms:

  • Direct Resistance Mechanisms:

    • Active efflux of antimicrobial compounds

    • Target protection, where the transporter interacts with the antibiotic target (e.g., BceAB protects lipid II from bacitracin)

    • Detoxification through transport of antibiotic breakdown products

  • System Organization and Function:

    • Many resistance-mediating ABC transporters in B. subtilis operate alongside two-component regulatory systems

    • These systems can sense antibiotics and upregulate expression of the transporters

    • Unlike conventional transporters, some B. subtilis ABC transporters confer resistance without actual transport of the antibiotic

  • Experimental Approaches to Study Resistance Functions:

    • Minimum inhibitory concentration (MIC) determination in wild-type vs. transporter knockout strains

    • Transport assays using fluorescently labeled antibiotics

    • Transcriptional profiling under antibiotic exposure conditions

    • Genetic screens to identify resistance determinants

  • Potential Applications in Biotechnology:

    • Engineering enhanced resistance for industrial strains

    • Developing inhibitors of resistance transporters to increase antibiotic efficacy

    • Using transporter expression as biosensors for antibiotic presence

For yurN specifically, researchers should investigate whether it contributes to intrinsic resistance against specific antimicrobial compounds, particularly those targeting cell envelope biosynthesis or function.

How can recombinant yurN be utilized in biotechnology applications?

Recombinant yurN and related transporters offer diverse biotechnological applications:

  • Biosensor Development:

    • Creating whole-cell biosensors where yurN transport activity is coupled to reporter gene expression

    • Developing in vitro detection systems using reconstituted transporters and fluorescent substrates

    • Engineering specificity through directed evolution to detect novel compounds

  • Protein Engineering Platforms:

    • Using the yurN expression and purification system as a model for other challenging membrane proteins

    • Developing membrane protein display technologies based on B. subtilis transporter architecture

    • Creating chimeric transporters with novel substrate specificities

  • Synthetic Biology Applications:

    • Engineering controlled substrate uptake systems for metabolic engineering

    • Designing export systems for small molecule production

    • Creating conditional transport systems responsive to specific signals

  • Vaccine and Therapeutic Delivery:

    • Exploiting B. subtilis spores expressing engineered yurN variants for targeted delivery

    • Developing recombinant B. subtilis strains with modified transport properties as probiotics

    • Creating antigen display systems based on transporter architecture

These applications build on the fundamental understanding of yurN structure and function, translating basic research into practical biotechnological tools.

What structural biology approaches are most suitable for investigating yurN structure and dynamics?

Multiple complementary techniques can provide insights into yurN structure:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Particularly suitable for membrane protein complexes

    • Can capture different conformational states during the transport cycle

    • Allows visualization of the complete ABC transporter complex

    • Sample preparation involves purification followed by reconstitution in nanodiscs or detergent micelles

  • X-ray Crystallography:

    • Provides high-resolution structural details

    • Challenging for membrane proteins but successful for several ABC transporters

    • May require extensive screening of crystallization conditions

    • Often employs lipidic cubic phase (LCP) crystallization for membrane proteins

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Suitable for studying dynamics and ligand binding

    • Can provide information on conformational changes during transport

    • Often limited to specific domains or segments rather than the full transporter

    • Isotopic labeling strategies can provide residue-specific information

  • Molecular Dynamics Simulations:

    • Computational approach to study dynamics at atomic resolution

    • Can model conformational changes during transport cycle

    • Allows investigation of substrate passage through the transport channel

    • Requires initial structural models from experimental techniques

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Provides information on protein dynamics and conformational changes

    • Can map regions involved in substrate binding or protein-protein interactions

    • Particularly useful for comparing different functional states of the transporter

When planning structural studies, researchers should consider starting with cryo-EM for the intact complex, complemented by high-resolution techniques for specific domains or interfaces.

What are the key unsolved questions regarding yurN and related ABC transporters in B. subtilis?

Several critical knowledge gaps remain in our understanding of yurN:

  • Substrate Specificity:

    • What are the natural substrates transported by yurN?

    • How is substrate specificity determined at the molecular level?

    • What structural features of the binding pocket confer selectivity?

  • Regulatory Networks:

    • How is yurN expression regulated in response to environmental conditions?

    • Which transcription factors control its expression?

    • How is its activity post-translationally regulated?

  • Integration with Cellular Functions:

    • What is the precise role of yurN in B. subtilis physiology?

    • How does it contribute to developmental processes like sporulation?

    • Does it play a role in antibiotic resistance or stress responses?

  • Structural Dynamics:

    • What conformational changes occur during the transport cycle?

    • How do the transmembrane and nucleotide-binding domains communicate?

    • What is the stoichiometry and assembly pathway of the functional complex?

  • Evolutionary Relationships:

    • How have yurN and related transporters evolved in different Bacillus species?

    • What functional adaptations distinguish transporters with different physiological roles?

    • Can evolutionary analysis predict substrate specificities or regulatory mechanisms?

Addressing these questions will require interdisciplinary approaches combining genetics, biochemistry, structural biology, and systems biology.

How can systems biology approaches enhance our understanding of ABC transporter functions in B. subtilis?

Systems-level approaches provide powerful frameworks for studying yurN within its cellular context:

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data to understand transporter regulation

    • Correlate transporter expression with metabolite profiles under various conditions

    • Identify coordinated responses involving multiple transporters and metabolic pathways

  • Network Analysis:

    • Map regulatory networks controlling transporter expression

    • Identify functional relationships between transporters and cellular processes

    • Construct predictive models of transporter activity based on environmental inputs

  • Single-Cell Approaches:

    • Investigate heterogeneity in transporter expression within populations

    • Study dynamic responses to environmental changes at single-cell resolution

    • Examine transporter localization and activity during differentiation processes

  • Genome-Scale Metabolic Modeling:

    • Incorporate transporter functions into genome-scale metabolic models

    • Predict the impact of transporter activity on cellular metabolism

    • Identify potential bottlenecks or intervention points for biotechnological applications

  • Comparative Genomics:

    • Analyze transporter distribution across Bacillus species

    • Correlate transporter repertoires with ecological niches and physiological capabilities

    • Identify conserved regulatory elements controlling transporter expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.