Recombinant Bacillus subtilis Probable amino-acid ABC transporter permease protein yckA (yckA)

Shipped with Ice Packs
In Stock

Description

Genetic Context and Protein Overview

YckA is encoded by the yckA gene (BSU_03370) in Bacillus subtilis and forms an operon with yckB. The protein belongs to the binding-protein-dependent transport system permease family (COG0765) and shares homology with amino acid ABC transporters .

Key Genetic and Molecular Features:

PropertyValue/Description
Molecular Weight25.08 kDa
Isoelectric Point (pI)9.43
LocalizationCell membrane
Protein FamilyABC transmembrane type-1 domain (aa 27-215)
EssentialityNon-essential
ParalogsTcyB, YxeN

Functional Role

YckA is classified as a probable amino-acid ABC transporter permease, though its exact substrate remains unconfirmed. ABC transporters typically utilize ATP hydrolysis to shuttle molecules across membranes . In B. subtilis, ABC permeases often function in nutrient uptake or toxin extrusion, but YckA’s specific biological role requires further validation .

Regulatory and Expression Data

  • Operon Structure: Co-transcribed with yckB, suggesting coordinated regulation .

  • Mutant Strains: Available mutants (e.g., MGNA-C001 with yckA::erm) show no essentiality under standard conditions .

Research Gaps and Future Directions

No studies directly addressing recombinant YckA expression or purification were identified. Current knowledge relies on genomic annotations and structural homology. Future work could:

  1. Express recombinant YckA in systems like E. coli for biochemical characterization.

  2. Validate substrate specificity using binding assays.

  3. Explore regulatory mechanisms of the yckBA operon.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yckA; BSU03370; Probable amino-acid ABC transporter permease protein YckA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yckA
Target Protein Sequence
MINSIQWEYIFNTKLAIESFPYVIKGIGYTLLISFVSMFAGTVIGLFISLARMSKLALLR WPAKLYISFMRGVPILVILFILYFGFPYIGIEFSAVTAALIGFSLNSAAYIAEINRSAIS SVEKGQWEAASSLGLSYWQTMRGIILPQSIRIALPPLANVLLDLIKASSLAAMITVPELL QHAKIIGGREFDYMTMYILTALIYWAICSIAAVFQNILEKKYAHYV
Uniprot No.

Target Background

Function
This protein is part of a binding-protein-dependent transport system. It is likely responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of yckA and how is it classified within ABC transporters in B. subtilis?

YckA is a probable amino acid ABC transporter permease protein in B. subtilis that belongs to the diverse superfamily of ATP-binding cassette (ABC) transporters. The B. subtilis genome contains the largest family of ABC transporters across its entire genome . YckA likely functions as part of a type I ABC importer system based on structural predictions and genomic analysis. These transporters typically consist of a periplasmic substrate-binding protein (SBP), membrane-spanning domains (MSDs) like yckA, and nucleotide-binding domains (NBDs) that hydrolyze ATP to power transport .

Genomic analysis tools like Subtiwiki provide valuable insights into the genomic context of yckA, allowing researchers to identify nearby genes that may comprise the complete transporter complex . ABC transporters in B. subtilis are typically organized in operons encoding all necessary components for transporter function.

How does the structure of yckA compare to other characterized ABC transporter permeases?

While limited experimental structures exist for B. subtilis ABC transporters, computational approaches like AlphaFold-Multimer provide valuable structural predictions. Based on similar Type I importers, yckA likely contains multiple transmembrane helices that form a substrate translocation pathway .

What biological functions are associated with amino acid ABC transporters like yckA in B. subtilis?

Amino acid ABC transporters in B. subtilis play crucial roles in nutrient acquisition, particularly in nutrient-limited environments like soil. These transporters enable the bacterium to import specific amino acids from the environment, supporting growth and survival when free amino acids are available as nutrient sources .

The specific amino acid substrate for yckA has not been definitively established from the available search results, but similar Type I importers in B. subtilis are involved in uptake of various substances including amino acids, di- and oligopeptides, sulfonate, and phosphate . Understanding yckA's substrate specificity is an important area for further research.

What molecular cloning strategies are most effective for expressing recombinant yckA in B. subtilis?

For expressing recombinant proteins in B. subtilis, integration-based and plasmid-based expression systems have been successfully employed. Based on approaches used for other membrane proteins in B. subtilis, researchers can consider the following strategies:

  • Integration-based expression: Genes can be integrated into the B. subtilis genome at specific loci such as the thrC locus using homologous recombination. This approach provides stable expression and has been successfully used for other membrane proteins .

  • Plasmid-based expression: Plasmids like pHCMC05 with IPTG-inducible promoters have been successfully used for protein expression in B. subtilis . These systems allow for controlled expression of recombinant proteins.

The choice of secretion signal is also important. For membrane proteins like yckA, using native B. subtilis secretion signals such as those derived from phrC can enhance proper membrane targeting .

How can I analyze the membrane localization and assembly of yckA in B. subtilis?

To analyze membrane localization and assembly of yckA, several methodological approaches can be employed:

  • Cell fractionation and immunoblotting: Cells expressing recombinant yckA can be fractionated to separate cell wall, membrane, and cytoplasmic components. For instance, lysozyme treatment (500 μg/ml) for 30 minutes at 37°C can solubilize cell walls . The fractions can then be analyzed by SDS-PAGE and immunoblotting using appropriate antibodies.

  • Protein tagging: Adding epitope tags (like His₆-tag) to yckA facilitates detection and purification. Care should be taken to position tags where they won't interfere with protein folding or function .

  • Protein extraction protocol for membrane proteins:

    • Grow B. subtilis cultures to appropriate density (OD₆₀₀ of 0.1)

    • Induce expression with 1 mM IPTG

    • Harvest cells by centrifugation at 3,000 × g for 10 minutes

    • Wash with STM buffer (50 mM Tris-HCl, pH 8.0, 25% sucrose, 5 mM MgCl₂)

    • Resuspend to equal cell densities (OD₆₀₀ ≈ 10)

    • Treat with lysozyme to solubilize cell walls

    • Separate protoplasts by centrifugation at 20,000 × g

What structural analysis techniques are appropriate for studying yckA?

Multiple approaches can be used to study the structure of yckA:

  • Computational structure prediction: AlphaFold-Multimer has proven effective for predicting structures of ABC transporter complexes in B. subtilis . This approach can provide initial structural insights into yckA and its interaction partners.

  • Experimental structure determination: While challenging for membrane proteins, techniques like cryo-EM have successfully determined structures of other B. subtilis ABC transporters such as BmrA and BmrCD . These approaches could be adapted for yckA.

  • Structure validation: Comparing computational predictions with experimental structures has revealed that AlphaFold predictions for some ABC transporters (like BmrCD) closely match experimental structures, while others show differences in conformation that may reflect dynamic states .

It's important to note that solubilization conditions (detergent, nanodisc, amphipol) can significantly influence the conformation of ABC transporters in experimental structure determination .

What transport assays can be used to characterize the substrate specificity of yckA?

To characterize substrate specificity of the yckA transporter, researchers can employ several complementary approaches:

  • Growth-based assays: Test the ability of B. subtilis strains expressing yckA (and its associated transporter components) to grow using specific amino acids as the primary nutrient source. Similar approaches have been used to demonstrate the ability of engineered B. subtilis to utilize specific substrates .

  • Radioactive substrate uptake assays: Using radiolabeled amino acids to directly measure transport activity in cells or membrane vesicles expressing the complete transporter complex.

  • Comparative analysis: The ability of each ABC transporter to recognize and transport specific solutes likely depends on the specific amino acid composition of substrate binding sites in the SBP and transmembrane domains, rather than gross differences in transporter structure . Sequence analysis and homology modeling can provide insights into potential substrate-binding residues.

How does the ATP-binding domain interact with the permease domain in ABC transporters like yckA?

The interaction between ATP-binding domains (NBDs) and permease domains (MSDs) is critical for transporter function. In Type I importers like those that likely include yckA:

  • Coupling helices: Transmembrane domains contain coupling helices that interact with the NBDs, transmitting conformational changes induced by ATP binding and hydrolysis .

  • Conformational states: ABC transporters cycle through different conformational states (inward-facing, outward-facing) driven by ATP binding and hydrolysis. AlphaFold predictions typically show Type I importers in an inward-facing conformation that resembles nucleotide-free states .

  • Interaction analysis: Experimental approaches like co-immunoprecipitation can be used to confirm interactions between yckA and its predicted partner NBD. For structural studies of the complete complex, co-expression of all components is typically necessary.

What is the relationship between yckA function and B. subtilis growth in different nutrient conditions?

The function of amino acid transporters like yckA is likely most relevant in nutrient-limited conditions where B. subtilis must scavenge available nutrients. To investigate this relationship:

  • Growth curve analysis: Compare growth of wild-type and yckA-deficient strains in minimal media supplemented with different amino acid sources.

  • Competition assays: Co-culture wild-type and yckA-mutant strains to assess competitive fitness under different nutrient conditions.

  • Transcriptional analysis: Monitor expression of yckA and its associated transporter genes under different growth conditions to identify regulatory patterns. Many ABC transporters show condition-specific expression.

How can site-directed mutagenesis be used to investigate the transport mechanism of yckA?

Site-directed mutagenesis offers powerful insights into transporter function. Based on structural predictions and knowledge of ABC transporters:

  • Target residue selection:

    • Conserved residues in transmembrane domains likely involved in substrate translocation

    • Residues in coupling helices that interact with NBDs

    • Potential substrate-binding residues identified by structural analysis or sequence conservation

  • Mutation design strategy:

    • Conservative substitutions to test the importance of specific physicochemical properties

    • Alanine scanning to identify functionally important residues

    • Introduction of reporter groups (e.g., cysteine residues for subsequent labeling)

  • Functional analysis of mutants:

    • Transport assays to measure effects on substrate specificity and transport kinetics

    • Growth phenotypes in different media conditions

    • Structural integrity verification through proper membrane localization

What approaches can be used to study the assembly of complete ABC transporter complexes containing yckA?

Studying the assembly of complete ABC transporter complexes requires multiple complementary approaches:

  • Co-expression strategies:

    • Multiple genes can be expressed from a single plasmid, as demonstrated for cellulases in B. subtilis

    • Sequential transformation with different plasmids carrying compatible selection markers

    • Integration of some components into the genome with plasmid-based expression of others

    Plasmid SystemCharacteristicsSelection MarkerReference
    pBL112B. subtilis-E. coli shuttle plasmid, integrates into thrC locusErythromycin
    pHCMC05B. subtilis expression plasmid with IPTG-inducible promoterChloramphenicol
  • Assembly verification:

    • Co-immunoprecipitation with differentially tagged components

    • Blue native PAGE to analyze intact complexes

    • Functional assays to confirm assembled complexes are active

  • Microscopy approaches:

    • Fluorescent protein fusions to visualize co-localization

    • FRET to detect direct interactions between components

How might comparative genomics inform our understanding of yckA evolution and specialization?

Comparative genomics approaches offer valuable insights into the evolution and specialization of ABC transporters like yckA:

  • Phylogenetic analysis:

    • Compare yckA sequences across diverse Bacillus species and related genera

    • Identify conserved and variable regions that may reflect functional constraints versus adaptive evolution

    • Map the evolutionary history of gene duplication and specialization events

  • Structural comparison:

    • Compare predicted structures of yckA homologs to identify structural conservation patterns

    • Analyze how structural variations correlate with organism lifestyle and habitat

  • Synteny analysis:

    • Examine conservation of genomic context around yckA across species

    • Identify co-evolved gene clusters that may function together

This approach can reveal how amino acid transporters have evolved specializations for different substrates or environmental conditions across bacterial species.

What are common challenges in expressing functional recombinant yckA and how can they be addressed?

Membrane proteins like yckA present several expression challenges:

  • Toxicity issues:

    • Challenge: Overexpression of membrane proteins can disrupt membrane integrity

    • Solution: Use tightly regulated inducible promoters with careful optimization of induction conditions

    • Approach: Start with low inducer concentrations (e.g., 0.1 mM IPTG) and shorter induction times

  • Protein misfolding:

    • Challenge: Improper folding leading to aggregation or degradation

    • Solution: Optimize expression temperature, often lower temperatures (25-30°C) improve folding

    • Approach: Consider co-expression with chaperones that facilitate membrane protein folding

  • Insertion into membrane:

    • Challenge: Inefficient targeting to the membrane

    • Solution: Use appropriate secretion signals from B. subtilis proteins, such as phrC

    • Approach: Verify membrane localization using fractionation and immunoblotting protocols

How can I verify that recombinant yckA assembles into functional transporter complexes?

Verification of functional assembly requires multiple lines of evidence:

  • Protein expression verification:

    • SDS-PAGE and immunoblotting of cell fractions to confirm expression and localization

    • Verification protocol should include proper controls (non-induced cells, empty vector)

  • Complex assembly:

    • Co-immunoprecipitation to confirm interaction with partner proteins

    • Size exclusion chromatography to analyze complex formation

  • Functional assays:

    • Transport assays using predicted substrates

    • Complementation of transporter-deficient strains

    • ATP hydrolysis assays to confirm energetic coupling

What considerations are important when designing experiments to study yckA regulation in different growth conditions?

Studying yckA regulation requires careful experimental design:

  • Media composition:

    • Define precise minimal media compositions with controlled amino acid availability

    • Use chemically defined media to eliminate variables from complex components

  • Growth phase considerations:

    • Monitor expression across growth phases (lag, exponential, stationary)

    • Standardize sampling based on growth parameters (OD₆₀₀) rather than time points

  • Transcriptional analysis approaches:

    • qRT-PCR for targeted analysis of yckA expression

    • RNA-Seq for genome-wide context of expression patterns

    • Reporter fusions (e.g., yckA promoter-GFP) for real-time monitoring

  • Protein level analysis:

    • Western blotting with specific antibodies or epitope tags

    • Targeted proteomics approaches for quantification

When analyzing results, remember that transport systems are often regulated in response to nutrient availability, with many ABC transporters showing repression when their substrates are abundant and induction during limitation of their specific substrates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.