Recombinant Bacillus subtilis Probable amino-acid permease protein yxeN (yxeN)

Shipped with Ice Packs
In Stock

Description

Protein Overview

YxeN is a 224-amino-acid permease component of the ABC transporter complex YxeMNO, which facilitates the uptake of sulfur-containing amino acids such as S-methylcysteine . It belongs to the bacterial solute-binding protein-dependent transport system permease family and is encoded by the yxeN gene (locus tag BSU39490) .

Expression and Purification

  • Expression Region: Amino acids 1–224 (full-length protein) .

  • Tag: Epitope tags (e.g., His-tag) are added during production for purification .

  • Storage: Stabilized in Tris-based buffer with 50% glycerol at −20°C or −80°C .

Applications

  • ELISA: Used to detect YxeN in biochemical assays .

  • Functional Studies: Investigating substrate specificity and transport kinetics .

Operon Structure

The yxe operon includes:

  1. yxeL: Encodes an N-acetyltransferase critical for detoxifying 2SC .

  2. yxeMNO: Encodes the ABC transporter components .

  3. yxeP: Encodes an amidohydrolase involved in cysteine salvage .

Metabolic Pathway

YxeN participates in a sulfur-salvage pathway that converts toxic 2SC into cysteine via:

  1. N-acetylation (YxeL) .

  2. Transport (YxeMNO) .

  3. Deacetylation (YxeP) .

Key Studies

  1. Substrate Competition

    • YxeN’s transport activity is competitively inhibited by dl-cystathionine and l-djenkolic acid (K_m = 2.5 μM) .

    • The YxeMNO system shows 13,000-fold higher catalytic efficiency for 2SC breakdown compared to alternative pathways .

  2. Genetic Knockout Effects

    • ΔyxeN mutants exhibit impaired growth on sulfur-limited media .

    • Accumulation of N-acetyl-2SC in ΔyxeK mutants confirms YxeN’s role in downstream metabolite processing .

Table 1: Kinetic Parameters of YxeL and Related Enzymes

EnzymeSubstrateK_m (μM)k_cat (s⁻¹)Catalytic Efficiency (k_cat/K_m)
YxeL2SC1.20.850.71
SnaA2SC640.00330.00005

Data derived from enzymatic assays .

Future Directions

  • Crystallization: High-resolution structural studies to elucidate substrate-binding pockets.

  • In Vivo Imaging: Tracking YxeN localization under sulfur-starved conditions.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributor for specific delivery time details.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
yxeN; BSU39490; LP9F; Probable amino-acid permease protein YxeN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yxeN
Target Protein Sequence
MNTIDWEFMISAFPTLIQALPITLFMAIAAMIFAIIGGLILALITKNKIPVLHQLSKLYI SFFRGVPTLVQLFLIYYGLPQLFPEMSKMTALTAAIIGLSLKNAAYLAEIFRAALNSVDD GQLEACLSVGMTKFQAYRRIILPQAIRNAIPATGNTFIGLLKETSLAFTLGVMEMFAQGK MYASGNLKYFETYLAVAIVYWVLTIIYSILQDLFERAMSKPYRT
Uniprot No.

Target Background

Function
This protein is likely part of the ABC transporter complex YxeMNO, which could be involved in amino-acid import. It might transport S-methylcysteine. This protein is probably responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the YxeN protein in Bacillus subtilis and what is its predicted function?

YxeN is a putative ABC transporter permease protein in Bacillus subtilis, consisting of 224 amino acids and belonging to the binding-protein-dependent transport system permease family . Current evidence suggests YxeN forms part of the ABC transporter complex YxeMNO that is likely involved in amino acid import, specifically S-methylcysteine transport . Within this complex, YxeN is probably responsible for the translocation of the substrate across the bacterial membrane, working in conjunction with YxeM (the substrate-binding lipoprotein) and YxeO (the ATP-binding protein) to facilitate amino acid transport .

Methodological approach to study function:

  • Generate knockout mutants and evaluate growth on minimal media with various amino acids

  • Perform complementation studies with wild-type yxeN

  • Use radioactive transport assays with labeled potential substrates

  • Compare substrate profiles with other characterized transporters

How is YxeN related to other transporter systems in Bacillus subtilis?

YxeN is part of the extensive network of transport proteins in B. subtilis. Genome analyses indicate that approximately 20% of B. subtilis membrane transport proteins participate in amino acid transport . YxeN shows significant functional relationships with other transporters, particularly the TcyABC system (TcyA, TcyB, TcyC) involved in L-cystine import . YxeN also shows connections to the high-affinity arginine ABC transporter (ArtP) . This network of transporters collectively contributes to B. subtilis' ability to utilize various sulfur-containing compounds as sole sulfur sources, including methionine, homocysteine, cystathionine, cystine, and others .

The relationship between these systems can be studied through:

  • Phenotypic analysis of single and combination knockout mutants

  • Transcriptional correlation analysis under various nutrient conditions

  • Competitive substrate uptake studies

  • Protein-protein interaction mapping

What are the predicted functional partners of YxeN?

Based on interaction network analysis, YxeN has several high-confidence functional partners:

ProteinFunctionInteraction ScoreEvidence
YxeOABC transporter (ATP-binding protein)0.999Part of YxeMNO complex
YxeMABC transporter (binding lipoprotein)0.999Part of YxeMNO complex
ArtPArginine ABC transporter binding lipoprotein0.983Functional relatedness
TcyACystine ABC transporter (substrate-binding lipoprotein)0.981Functional relatedness
YxePPutative amidohydrolase0.974Metabolic pathway connection
TcyCCystine ABC transporter (ATP-binding protein)0.941Functional pathway connection
YxeLPutative acetyltransferaseUndeterminedMetabolic pathway connection

These partners suggest that YxeN functions within a broader network involved in amino acid transport and metabolism, particularly sulfur-containing amino acids .

What methods are commonly used to express recombinant YxeN protein?

Expression of recombinant YxeN can be achieved using several established protocols:

  • Vector selection:

    • pHT43 is commonly used for B. subtilis expression with IPTG induction

    • Inducible promoters allow controlled expression of membrane proteins

  • Host strain selection:

    • B. subtilis WB800N is preferred as it lacks eight extracellular proteases, minimizing protein degradation

    • E. coli systems can be used for initial cloning but may not properly fold membrane proteins

  • Expression protocol:

    • Culture cells to mid-log phase (OD600 = 0.5)

    • Induce with 0.1M IPTG and continue culture for 3 hours

    • Harvest cells and wash with PBS

    • Disrupt cells by ultrasonication for protein extraction

  • Verification:

    • Western blot analysis using specific antibodies or tag detection

    • Visualization using Super ECL Plus system

How can I characterize the substrate specificity of YxeN?

Determining YxeN's precise substrate specificity requires a multifaceted approach:

  • Comparative transport assays:

    • Generate a ΔyxeN mutant and test uptake of potential substrates

    • Reference systems like TcyABC (Km = 0.6 μM for L-cystine) and TcyJKLMN (Km = 2.5 μM for L-cystine) can serve as controls

    • Test inhibition by structural analogs (as seen with seleno-DL-cystine for TcyP)

  • Competition studies:

    • Test substrate uptake in the presence of potential competitors

    • Evaluate sulfur-containing compounds like S-methylcysteine, cystathionine, and djenkolic acid

    • Determine IC50 values for competing substrates

  • Growth phenotyping:

    • Assess growth of ΔyxeN mutants with different sulfur sources

    • Create a triple mutant lacking all cystine transport systems (similar to ΔtcyP ΔtcyJKLMN ΔtcyABC)

    • Perform complementation studies with yxeN expression constructs

  • Reconstitution in membrane vesicles:

    • Purify YxeN and reconstitute in proteoliposomes with YxeM and YxeO

    • Measure direct transport using fluorescent or radioactively labeled substrates

What approaches can I use to study the regulation of yxeN expression?

Understanding yxeN regulation requires examining transcriptional responses to environmental conditions:

  • Transcriptomic analysis:

    • RNA-seq analysis under varying sulfur availability conditions

    • Compare expression profiles when using methionine versus sulfate as sole sulfur source

    • Analyze correlations with other sulfur metabolism genes

  • Promoter analysis:

    • Identify transcription factor binding sites in the yxeN promoter region

    • Create promoter-reporter fusions (e.g., yxeN'-lacZ) to monitor expression

    • Test expression in regulatory mutant backgrounds

  • Regulatory network mapping:

    • Previous studies have shown that many transporters have increased expression when their imported amino acid is depleted

    • Investigate whether yxeN follows this pattern of regulation

    • Identify global regulators controlling yxeN expression

  • Post-transcriptional regulation:

    • Examine mRNA stability and translation efficiency

    • Assess the role of accessibility of translation initiation sites as a key factor in recombinant protein expression

    • Test synonymous substitutions in the first nine codons to optimize expression

How can I design efficient genetic modifications of B. subtilis for YxeN studies?

Genetic engineering of B. subtilis for YxeN studies can employ several strategies:

  • Gene knockout approach:

    • Use fusion PCR to create knockout constructs with:

      • 800 bp upstream homology region

      • lox71-zeo-lox66 resistance cassette

      • 800 bp downstream homology region

    • Transform purified constructs into B. subtilis

    • Select transformants using zeocin resistance

    • Remove the resistance marker using Cre/lox system for marker-free deletions

  • Expression optimization:

    • Modify translation initiation sites to increase accessibility

    • Implement synonymous substitutions in the first nine codons

    • Accessibility of translation initiation sites (-25:16 region) significantly correlates with protein expression levels

  • Chassis strain development:

    • Consider using modified B. subtilis chassis strains with improved properties

    • Strains with knockouts in autolysis genes (lytC, sigD, pcfA, flgD) show increased biomass (12-20%)

    • Knockout of prophage-associated gene xpf increases biomass by 10%

    • Modification of spore-associated genes can further enhance recombinant protein production

  • Production scale-up:

    • Implement two-stage seed expansion culture

    • Use DO-stat fed-batch fermentation strategy for optimal production

    • For mid-scale testing, 100 mL seed culture can be scaled to 5L bioreactors

How does structure influence the function of YxeN, and what methods can elucidate its structure?

While the specific structure of YxeN has not been fully characterized, insights can be drawn from related proteins:

How can I integrate YxeN function into the broader metabolic network of B. subtilis?

Understanding YxeN's role in the cellular metabolic network requires:

  • Metabolomics approach:

    • Compare intracellular amino acid pools between wild-type and ΔyxeN strains

    • Monitor flux of sulfur-containing compounds

    • Examine metabolic adaptations to YxeN deficiency

  • Systems biology integration:

    • Map connections between YxeN and other sulfur metabolism components

    • The connection with YxeP (putative amidohydrolase) and YxeL (putative acetyltransferase) suggests involvement in a pathway for S-(2-succino)cysteine degradation

    • This pathway may allow B. subtilis to use S-(2-succino)cysteine as a sole sulfur source

  • Comparative analysis with related transporters:

    • Compare with the three L-cystine uptake systems in B. subtilis (TcyP, TcyJKLMN, TcyABC)

    • Assess substrate overlap and specialization

    • Evaluate redundancy and compensatory mechanisms

  • Evolutionary analysis:

    • Compare YxeN with transporters in related Bacillus species

    • Assess conservation of the YxeMNO system across bacterial lineages

    • Identify species-specific adaptations in substrate specificity

What are the challenges in purifying functional YxeN protein and how can they be addressed?

Purification of membrane proteins like YxeN presents specific challenges:

  • Extraction optimization:

    • Test various detergents for solubilization (DDM, LDAO, etc.)

    • Optimize buffer conditions (pH, salt concentration, glycerol)

    • Consider nanodiscs or styrene maleic acid lipid particles (SMALPs) for native-like environments

  • Expression system selection:

    • B. subtilis WB800N provides advantages for homologous expression

    • IPTG-inducible systems with optimized RBS accessibility enhance yields

    • Codon optimization may improve expression levels

  • Functional validation:

    • Develop binding assays with purified YxeN

    • Reconstitute with YxeM and YxeO to test transport activity

    • Use fluorescent substrate analogs to monitor binding events

  • Stability enhancement:

    • Screen additives to improve protein stability

    • Identify optimal storage conditions

    • Consider fusion tags that enhance solubility without compromising function

How can accessibility of translation initiation sites be optimized for efficient YxeN expression?

Recent studies have revealed the importance of mRNA structure in translation efficiency:

  • Predictive modeling approach:

    • Calculate accessibility of translation initiation sites using Boltzmann's ensemble

    • Focus on the -25:16 region relative to the start codon

    • This measure significantly outperforms alternative features in predicting expression success

  • Optimization strategies:

    • Implement synonymous substitutions in the first nine codons

    • TIsigner software uses simulated annealing to identify optimal sequences

    • Higher accessibility leads to higher protein production

  • Experimental validation:

    • Compare expression levels between optimized and native sequences

    • Monitor translation efficiency using reporter fusions

    • Measure protein yields under various induction conditions

  • Trade-off considerations:

    • Higher accessibility may lead to higher protein production but slower cell growth

    • This supports the concept of protein cost, where cell growth is constrained during overexpression

    • Balance expression optimization with physiological impact

What novel methodologies can be applied to study YxeN transport kinetics?

Advanced techniques for studying transport kinetics include:

  • Real-time transport measurements:

    • Develop fluorescent substrate analogs that change properties upon transport

    • Use pH-sensitive fluorescent proteins to monitor proton-coupled transport

    • Implement microfluidic systems for single-cell transport analysis

  • High-resolution kinetic analysis:

    • Determine transport rates at millisecond resolution

    • Identify rate-limiting steps in the transport cycle

    • Compare with known transporters like TcyP (Km = 0.6 μM for L-cystine)

  • In vivo dynamics:

    • Use FRET-based sensors to monitor substrate transport in living cells

    • Implement optogenetic control of transporter activity

    • Correlate transport activity with cellular metabolic state

  • Computational kinetic modeling:

    • Develop mathematical models of the transport cycle

    • Incorporate ATP hydrolysis coupling mechanisms

    • Simulate responses to varying substrate concentrations

Why might recombinant YxeN expression fail and how can I address these issues?

Membrane protein expression faces several common challenges:

  • Toxicity assessment:

    • Membrane protein overexpression can disrupt membrane integrity

    • Implement tightly controlled induction systems

    • Consider reduced growth temperatures to slow expression

  • Protein misfolding:

    • Nearly 50% of recombinant proteins fail to express in host cells

    • Optimize translation initiation site accessibility

    • Consider molecular chaperone co-expression

  • Proteolytic degradation:

    • Use protease-deficient strains like B. subtilis WB800N

    • Add protease inhibitors during extraction

    • Optimize cell lysis conditions to minimize degradation

  • Detection limitations:

    • Implement sensitive detection methods (fluorescent tags, specific antibodies)

    • Consider enrichment of membrane fractions before analysis

    • Use multiple detection methods to confirm expression

How can I systematically troubleshoot growth defects in YxeN mutant strains?

When YxeN mutants show unexpected phenotypes:

  • Complementation analysis:

    • Express wild-type YxeN from an inducible promoter

    • Create point mutations in key functional residues

    • Test domain swaps with related transporters

  • Media optimization:

    • Vary amino acid availability in growth media

    • Test different sulfur sources (organic vs. inorganic)

    • Implement defined minimal media to precisely control nutrients

  • Compensatory mechanism identification:

    • Analyze upregulation of alternative transporters

    • Screen for suppressor mutations

    • Implement adaptive laboratory evolution to identify compensatory pathways

  • Physiological assessment:

    • Examine cell morphology for stress indicators

    • Monitor growth parameters (lag phase, doubling time, final density)

    • Measure metabolic indicators like ATP levels and redox state

What are the critical parameters for successful genetic manipulation of the yxeN locus?

For optimal genetic engineering outcomes:

  • Transformation optimization:

    • Use freshly prepared competent cells

    • Optimize DNA concentration and quality

    • Implement recovery phases after transformation

  • Homology arm design:

    • Use 800 bp homology regions for efficient recombination

    • Avoid repetitive sequences that could cause off-target integration

    • Consider the impact of genome structure at the target locus

  • Selection strategy:

    • Implement appropriate antibiotic selection (e.g., zeocin)

    • Consider counterselection methods for marker removal

    • Use Cre/lox system for clean deletions

  • Verification thoroughness:

    • PCR verification of integration events

    • Sequencing of junction regions

    • Functional characterization of the modified strain

How might YxeN be engineered for biotechnological applications?

Potential applications include:

What can comparative genomics tell us about the evolution of YxeN and related transporters?

Evolutionary insights can guide functional studies:

  • Phylogenetic analysis:

    • Compare YxeN sequences across Bacillus species and beyond

    • Identify conserved residues as candidates for functional importance

    • Track gene duplication and specialization events

  • Genome context analysis:

    • Examine conservation of the yxeMNO operon structure

    • Identify co-evolved genes that may have functional relationships

    • Compare with syntenic regions in related organisms

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify sites under positive selection

    • Compare evolutionary rates between core domains and variable regions

    • Correlate evolutionary conservation with structural elements

  • Horizontal gene transfer assessment:

    • Evaluate evidence for lateral acquisition of transport systems

    • Compare codon usage and GC content with genomic averages

    • Identify potential source organisms for horizontally acquired components

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.