Recombinant Bacillus subtilis Probable anti-sigma-M factor yhdL (yhdL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yhdL; BSU09510; Probable anti-sigma-M factor YhdL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yhdL
Target Protein Sequence
MMNEEFKKRFDQYKNGEMSDQEMTAFEEELEKLEVYQELIDSELEDDNDWDLSISPEKQK AILAYGKRKSYLRISVLAVISTLMILPLCTLGSYLYYGMGGKHSTGNEFMETAAVTVALT MPNVLVDTSGLKSQVKLFGMNTEFPLQKQIGTKTAAVGNERVEMFYNKVKAPAVNYYDLE VNKTGHYFTHPSNKSEQTTAKAEKTLSTLPEGTVSEVYLSYDRAYPTKDVYNKFKGYDVS FLWNAIETEKNTNKTASTEPLGYPGKDSKFLAALNTKGKSNGDQFINALKFMSKHEKWAQ VISKRKDLNVDNRLDYVEKNGVNVYGSVVTGPTKEIQRMLKNKSVKSANVGEVELWNW
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YhdL and what is its role in Bacillus subtilis?

YhdL is an integral membrane protein that functions as an anti-sigma factor for the extracytoplasmic function (ECF) sigma factor SigM in Bacillus subtilis. It is encoded within the sigM-yhdL-yhdK operon and, together with YhdK, forms the functional anti-sigma factor complex (YhdLK) that holds SigM inactive at the membrane under non-stress conditions .

The YhdL protein contains a transmembrane domain, with its N-terminal region interacting directly with SigM as determined through yeast two-hybrid analysis . Unlike many other membrane-anchored anti-sigma factors, the release of SigM from the YhdLK complex is not controlled by regulated proteolysis but appears to occur through allosteric control mechanisms .

How does the sigM-yhdL-yhdK operon structure affect YhdL expression and function?

The sigM-yhdL-yhdK operon is transcribed from two distinct promoters:

  • A constitutive SigA-controlled promoter (PA)

  • An autoregulatory SigM-controlled promoter (PM)

This dual control creates a regulatory circuit where SigM can enhance its own expression through positive feedback . The operon structure ensures co-expression of SigM with its regulatory proteins YhdL and YhdK, allowing for tight control of SigM activity. When designing experiments to study YhdL function, researchers must consider this autoregulatory circuit, as disruption of YhdL without addressing the positive feedback loop results in lethal overexpression of SigM .

Why is YhdL essential for Bacillus subtilis viability?

YhdL is essential for B. subtilis viability because its absence leads to toxic levels of SigM activity due to unchecked positive autoregulation . Research has demonstrated that deletion of yhdL results in runaway activation of sigM expression, causing severe growth defects and eventual cell death . This toxicity stems from several factors:

  • Unregulated expression of SigM-dependent genes disrupts normal cellular processes

  • Resources are diverted away from essential cell functions

  • The excessive activation of cell wall synthesis pathways leads to morphological defects

The essentiality of YhdL can be experimentally demonstrated through depletion experiments using IPTG-regulated alleles, which show that cells lacking YhdL rapidly accumulate suppressor mutations in sigM or display severe growth inhibition .

How can researchers generate conditional yhdL mutants for functional studies?

Given the essentiality of yhdL, direct knockout approaches result in lethality or rapid accumulation of suppressor mutations. Instead, researchers can employ several methodological approaches to study YhdL function:

Method 1: IPTG-inducible expression systems

  • Replace the native yhdL promoter with an IPTG-dependent promoter (Pspac)

  • Culture cells in the presence of IPTG to maintain YhdL expression

  • Remove IPTG to deplete YhdL and observe consequences

  • Monitor growth rates, cell morphology, and SigM activity using reporters

Method 2: sigM merodiploid approach

  • Maintain the native sigM-yhdL-yhdK operon

  • Introduce an ectopic copy of sigM under control of only its PA promoter (without PM)

  • This strain exhibits intermediate SigM activity without lethality

  • Use for suppressor screens or phenotypic characterization

Method 3: Partial suppression using housekeeping sigma factor

  • Construct a xylose-inducible PxylA-sigA strain

  • Express SigA at higher levels to compete with SigM for RNA polymerase binding

  • In the presence of xylose, yhdL mutants show improved viability

  • This approach allows assessment of partial YhdL function loss

What reporter systems are most effective for studying YhdL-SigM interactions?

Several reporter systems have proven effective for studying YhdL-SigM interactions:

Reporter SystemConstructionAdvantagesApplications
PM-lux luciferase reporterSigM-responsive promoter fused to luciferaseQuantitative measurement, real-time monitoringMeasuring SigM activity in various genetic backgrounds
PamJ-yfp fluorescence reporterSigM-responsive promoter fused to YFPSingle-cell resolution, microscopy compatibleVisualizing SigM activity at cellular level, antibiotic response studies
PA and PM promoters directing lacZ expressionIndividual promoters from sigM operon fused to lacZDistinguishes between constitutive and autoregulatory expressionDissecting promoter contributions to sigM expression

When designing reporter experiments, researchers should consider:

  • Background strain characteristics (PY79 vs. 168)

  • Growth media composition affects SigM activity

  • Appropriate controls to account for growth phase effects

  • Time-course measurements to capture dynamic responses

How can researchers validate direct YhdL-SigM interactions experimentally?

To validate direct interactions between YhdL and SigM, researchers can employ several complementary approaches:

In vivo approaches:

  • Bacterial two-hybrid assays: Fuse YhdL and SigM to complementary fragments of a reporter protein to detect interactions in bacterial cells.

  • Co-immunoprecipitation: Use antibodies against YhdL or SigM to pull down protein complexes and identify interaction partners through Western blotting.

  • Crosslinking followed by mass spectrometry: Employ chemical crosslinkers to stabilize protein-protein interactions in vivo, followed by purification and identification of interaction partners.

In vitro approaches:

  • Yeast two-hybrid analysis: As previously demonstrated, fusion of YhdL N-terminal domain with SigM in yeast two-hybrid systems can validate direct interactions .

  • Surface plasmon resonance: Immobilize purified SigM or YhdL on a sensor chip and measure binding kinetics of the partner protein.

  • Pull-down assays with purified proteins: Express and purify tagged versions of YhdL and SigM to directly assess binding in controlled conditions.

When interpreting interaction data, researchers should consider the membrane localization of YhdL and potential conformational changes that may affect interactions under different conditions .

How does the YhdLK complex sense undecaprenyl phosphate (UndP) levels to regulate SigM activity?

Recent research has revealed that the YhdLK complex functions as a sensor for undecaprenyl phosphate (UndP) levels, a limited lipid carrier essential for cell wall synthesis. The mechanism appears to operate as follows:

  • When UndP levels are sufficient, the YhdLK complex sequesters SigM at the membrane, maintaining low SigM activity

  • When UndP levels decrease (due to antibiotic treatment or genetic perturbations), SigM is released from YhdLK

  • Released SigM activates genes that increase peptidoglycan synthesis, UndP recycling, and liberation of UndP from non-essential pathways

This model is supported by several experimental findings:

  • Antibiotics that trap UndP or UndP-linked intermediates rapidly deplete the UndP pool and trigger SigM release within minutes

  • Depletion of enzymes involved in UndP biosynthesis (UppS, IspH) strongly increases SigM activity

  • Overexpression of UppS (UndP synthase) suppresses SigM activation in various genetic backgrounds

While direct binding of UndP to the YhdLK complex has not been demonstrated, the current model suggests allosteric regulation of YhdL by UndP binding, which stabilizes the YhdLK-SigM interaction .

What genetic suppressors can alleviate YhdL deficiency, and what do they reveal about SigM regulation?

Several classes of genetic suppressors can alleviate the lethality associated with YhdL deficiency:

1. RNA polymerase core enzyme mutations
Researchers have identified suppressor mutations in the beta (β) and beta-prime (β') subunits of RNA polymerase that selectively reduce SigM activity. These mutations are located at the sigma-core interface and differentially affect alternative sigma factor activity. They reveal how specific interactions between the core enzyme and sigma factors can modulate transcriptional output .

2. SigA overexpression
Overexpression of the housekeeping sigma factor SigA can suppress SigM toxicity by competing with SigM for binding to the RNA polymerase core enzyme. This competition-based suppression demonstrates the importance of sigma factor balance in bacterial transcription regulation .

3. Promoter mutations
Mutations in the SigM-dependent autoregulatory promoter (PM) of the sigM operon can partially suppress the growth defects of yhdL and yhdK mutants by disrupting the positive feedback loop that amplifies SigM levels .

4. YidC1 (SpoIIIJ) gain-of-function mutations
Specific amino acid substitutions in the YidC1 membrane protein insertase can suppress the lethality of high SigM activity. These mutations typically increase positive charge in a functionally important hydrophilic groove of YidC1, suggesting they might counteract membrane insertion defects caused by overactive SigM .

These suppressors collectively reveal multiple mechanisms for regulating alternative sigma factor activity and provide insights into the interconnected nature of bacterial stress response pathways.

How does YhdL contribute to antibiotic resistance in Bacillus subtilis?

The YhdL-SigM regulatory pathway plays a critical role in antibiotic resistance through several mechanisms:

  • Sensing cell wall-targeting antibiotics:

    • YhdLK complex responds to antibiotics that deplete UndP or trap UndP-linked intermediates

    • Different antibiotics trigger distinct temporal patterns of SigM activation based on their mode of action

  • Activating cell wall synthesis and repair genes:

    • Upon release from YhdLK, SigM upregulates genes involved in:

      • Peptidoglycan precursor synthesis

      • Cell wall polymerization and cross-linking

      • UndP recycling and liberation from non-essential pathways

  • Mediating stress adaptation:

    • SigM activation contributes to resistance against:

      • Cell wall antibiotics (vancomycin, bacitracin, phosphomycin)

      • Salt stress

      • Acid stress (pH 4.3)

      • Ethanol stress (5%)

The importance of YhdL in this process is demonstrated by experiments showing that controlled activation of SigM (through partial YhdL inhibition) can confer enhanced resistance to cell wall antibiotics, while complete loss of YhdL function is lethal due to runaway SigM activation .

What are the methodological challenges in studying YhdL-SigM interactions in their native membrane environment?

Studying YhdL-SigM interactions presents several methodological challenges:

  • Membrane protein biochemistry limitations:

    • YhdL and YhdK are integral membrane proteins, making them difficult to purify while maintaining native conformation

    • Detergent solubilization may disrupt authentic interactions with SigM

    • Reconstitution into artificial membrane systems may not recapitulate the native environment

  • Technical approaches to overcome these challenges:

    • Nanodiscs or styrene maleic acid lipid particles (SMALPs) can maintain membrane proteins in a more native-like environment

    • Site-specific crosslinking approaches using unnatural amino acids can capture transient interactions

    • Super-resolution microscopy to visualize YhdL-SigM interactions in intact cells

    • Cryo-electron microscopy of membrane fractions containing YhdL-SigM complexes

  • Experimental considerations:

    • The putative UndP binding to YhdLK requires specialized lipid biochemistry techniques

    • Dynamic nature of the interaction requires time-resolved methods

    • Low abundance of the native complexes necessitates sensitive detection methods

Future research should focus on developing methods to directly visualize and measure YhdL-SigM interactions in the membrane context, potentially employing synthetic biology approaches to engineer reporter systems that respond to these interactions.

How can researchers differentiate between direct and indirect effects of YhdL dysfunction?

Differentiating between direct and indirect effects of YhdL dysfunction presents a significant challenge due to the complex regulatory networks affected by SigM activation. Researchers can employ several strategies:

  • Temporal analysis of gene expression changes:

    • Use time-course RNA-seq or proteomics following controlled YhdL depletion

    • Identify immediate vs. delayed responses to distinguish direct SigM targets from secondary effects

    • Correlate expression changes with SigM binding using ChIP-seq approaches

  • Genetic separation of effects:

    • Engineer strains with mutations in specific SigM-dependent promoters

    • Systematically delete SigM-regulated operons to identify those contributing to specific phenotypes

    • Data from one study showed that mutation of specific SigM-dependent promoters controlling operons encoding integral membrane proteins improved cell growth under high SigM conditions

  • Suppressor analysis:

    • Identify genetic backgrounds that suppress specific aspects of the YhdL deficiency phenotype

    • For example, research has shown that the fitness defect caused by high SigM activity is exacerbated in the absence of SecDF protein translocase or SigM-dependent induction of the Spx oxidative stress regulon

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics to build comprehensive models of cellular responses

    • Use computational approaches to infer direct vs. indirect regulatory relationships

By applying these approaches systematically, researchers can construct more accurate models of the primary and secondary effects of YhdL dysfunction on cellular physiology.

What evolutionary insights can be gained from studying YhdL homologs across different bacterial species?

The YhdLK-SigM pathway is confined to B. subtilis and close relatives within the genus Bacillus, providing an interesting case for evolutionary analysis . Research into YhdL homologs can yield several important insights:

  • Diversity of anti-sigma factor mechanisms:

    • Compare YhdL with anti-sigma factors from other bacterial species

    • Analyze how different bacteria have evolved mechanisms to regulate ECF sigma factors

    • Identify conserved domains or motifs that indicate functional convergence

  • Evolutionary adaptations to different ecological niches:

    • Examine whether YhdL homologs in different Bacillus species show adaptation to specific environmental conditions

    • Investigate correlation between YhdL sequence diversity and natural habitat characteristics

    • Determine if soil-dwelling vs. host-associated Bacillus species show different regulatory mechanisms

  • Methodological approaches for evolutionary studies:

    • Comparative genomics across Bacillus species to identify conservation patterns in yhdL and associated genes

    • Heterologous expression of YhdL homologs to test functional complementation

    • Phylogenetic analysis combined with experimental validation of key residues for function

    • Synthetic biology approaches to reconstruct ancestral forms of the YhdLK complex

  • Applications of evolutionary insights:

    • Development of species-specific antibiotics targeting unique features of the YhdL-SigM pathway

    • Engineering of synthetic regulatory circuits based on natural diversity of anti-sigma factor mechanisms

    • Understanding the evolution of essential gene networks in bacteria

These evolutionary perspectives can provide valuable context for interpreting experimental results and may inspire novel approaches to manipulate bacterial gene regulation for research or biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.