Recombinant Bacillus subtilis Probable biotin transporter BioY (bioY)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Probable Biotin Transporter BioY (bioY)

The Recombinant Bacillus subtilis Probable biotin transporter BioY (bioY) is a genetically engineered version of the BioY protein, which is involved in biotin transport across cell membranes. Biotin is a crucial vitamin for various metabolic processes, and its transport is essential for cellular functions. The BioY protein is part of the Energy-Coupling Factor (ECF) transporters, which are responsible for the uptake of vitamins and other nutrients in bacteria.

Function of BioY in Biotin Transport

BioY proteins are known to mediate biotin transport into bacterial cells. In some organisms, BioY functions independently of other ECF transporter components, acting as a solitary biotin transporter . The role of BioY in biotin transport has been studied extensively, with evidence showing that it can bind biotin with high affinity and facilitate its transport across the cell membrane .

Biotin Biosynthesis in Bacillus subtilis

Bacillus subtilis is a model organism for studying biotin biosynthesis due to its genetic tractability and ability to produce biotin from pimelic acid, a precursor molecule . The biotin biosynthetic pathway in B. subtilis involves several genes, including bioW, which encodes a pimeloyl-CoA synthetase essential for converting pimelic acid into pimeloyl-CoA, a critical step in biotin synthesis .

Engineering Bacillus subtilis for Enhanced Biotin Production

Metabolic engineering of B. subtilis has been explored to enhance biotin production. Strategies include relieving feedback repression of biotin synthesis and deleting biotin uptake proteins to increase desthiobiotin and biotin titers . The biotin synthase (BioB) enzyme is a rate-limiting step in biotin production, and efforts to improve its catalytic activity are crucial for efficient biotin synthesis .

Data Table: Biotin Production in Engineered Bacillus subtilis Strains

Strain ModificationDesthiobiotin (DTB) Titer (mg/L)Biotin Titer (mg/L)
Wild-typeNot reportedLess than 10 μg/L
Engineered strain21.62.7
Enhanced BioB activityNot significantly improved11.2 (after optimization)

Note: The table summarizes key findings from metabolic engineering efforts to enhance biotin production in B. subtilis.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
bioY; yhfU; BSU10370; Probable biotin transporter BioY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
bioY
Target Protein Sequence
MLKLIDMMHIAIFTALMAVLGFMPPLFLSFTPVPITLQTLGVMLAGSILRPKSAFLSQLV FLLLVAFGAPLLPGGRGGFGVFFGPSAGFLIAYPLASWLISLAANRLRKVTVLRLFFTHI VFGIIFIYLLGIPVQAFIMHIDLSQAAFMSLAYVPGDLIKAAVSAFLAIKITQALSLSDT MFTKGG
Uniprot No.

Target Background

Function
Probable biotin transporter.
Database Links
Protein Families
BioY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is BioY and what is its role in Bacillus subtilis?

BioY is a substrate-specific transmembrane protein that functions as a biotin transporter in Bacillus subtilis and other prokaryotes. This integral membrane protein facilitates the uptake of biotin (vitamin B7) from the extracellular environment into the bacterial cell. In prokaryotic systems, BioY can function either as a solitary transporter or as part of a larger energy-coupling factor (ECF) transporter complex called BioMNY .

The BioY protein functions differently depending on its association state:

  • As a solitary protein: Functions as a high-capacity, low-affinity biotin transporter

  • As part of BioMNY complex: Forms a high-affinity biotin transport system

In Bacillus subtilis, BioY plays a crucial role in biotin acquisition, particularly in environments where biotin availability is limited .

How does the structure of BioY relate to its transport function?

BioY contains six transmembrane helices with the last helix (TM6) playing a critical role in biotin recognition and binding. Structural studies have identified conserved amino acid residues that are essential for function, particularly Asp164 and Lys167 in the sixth transmembrane helix .

Research has demonstrated that BioY forms functional dimers in living cells. Each dimer appears to bind one biotin molecule at a stoichiometry of approximately 1:2 (biotin:BioY monomer) . The dimerization creates the binding pocket necessary for biotin recognition and transport.

Experimental evidence from fluorescence anisotropy analysis and FRET studies confirms that BioY proteins oligomerize in vivo, and this oligomerization is required for proper transport function .

What are the most effective methods for expressing recombinant BioY in heterologous systems?

Heterologous expression of BioY has been successfully achieved in Escherichia coli strains deficient in biotin transport and synthesis. The methodology typically involves:

  • Vector selection: Plasmids with appropriate promoters (e.g., P43, Pveg for B. subtilis) for the heterologous host

  • Expression optimization:

    • Temperature: 30-37°C

    • Induction: IPTG or constitutive expression

    • Growth media: LB or minimal media supplemented with appropriate nutrients

  • Strain selection: E. coli S1039 (biotin transport-deficient) has been used successfully as demonstrated by Hebbeln et al.

  • Verification approaches:

    • Transport assays using [³H]biotin

    • Growth complementation on minimal media with trace biotin levels

    • Western blotting to confirm expression

When expressing BioY alone or as part of the BioMNY complex, it is important to consider that BioY functions as a high-capacity, low-affinity transporter when expressed alone, but becomes a high-affinity system when co-expressed with BioMN .

How can researchers accurately measure BioY-mediated biotin transport activity?

Several complementary approaches have been developed for quantifying BioY transport activity:

  • Radioactive transport assays:

    • Substrate: [³H]biotin at concentrations from 100pM to 200nM

    • Cell preparation: Recombinant cells expressing BioY variants

    • Incubation: Typically 1-5 minutes at room temperature

    • Analysis: Rapid filtration followed by scintillation counting

  • Growth complementation assays:

    • Strains: Biotin auxotrophs expressing BioY variants

    • Media: Minimal media with defined biotin concentrations (1-100nM)

    • Measurement: Growth rates and final cell densities

  • Kinetic analysis parameters to determine:

    • V<sub>max</sub>: For solitary BioY, approximately 60 pmol × min⁻¹ × (mg protein)⁻¹

    • K<sub>m</sub>: For solitary BioY, approximately 250 nM; for BioMNY complex, approximately 5 nM

Comparing kinetic parameters between different BioY variants or between BioY alone versus BioMNY complex provides valuable insights into transport mechanism and efficiency .

BioY VariantV<sub>max</sub> (pmol × min⁻¹ × mg⁻¹)K<sub>m</sub> (nM)Transport Efficiency
Solitary BioY~60~250High capacity, low affinity
BioMNY complex~6~5Low capacity, high affinity
BioY (K167R)Inactive-No transport
BioY (D164N)Inactive-No transport

How does the oligomeric state of BioY influence its transport mechanism?

The oligomeric state of BioY is critical for its transport function, as evidenced by multiple experimental approaches:

  • Mass spectrometry analysis: Purified BioY monomers bind biotin at a stoichiometry of 1:2 (biotin:BioY), suggesting that two BioY peptides form one functional unit for biotin binding .

  • Covalently linked dimers: Research with artificially constructed tail-to-head-linked BioY dimers demonstrates that:

    • The covalently linked dimer shows similar transport activity to monomeric BioY

    • Fluorescence anisotropy confirms that both monomeric and dimeric BioY oligomerize in vivo

    • The dimer binds biotin at a ratio of 1:4 (referring to single BioY domains), indicating dimers of dimers form the functional unit

  • Mutational studies: When conserved residues (D164, K167) are mutated in one domain of the covalently linked dimer:

    • Transport activity is reduced to 25% (D164N and K167R) or 75% (K167Q)

    • Biotin binding is only slightly affected

    • This suggests intermolecular interactions between domains from different dimers are essential for transport function

The research indicates that BioY proteins form functional dimers, and these dimers may further associate to create the actual transport unit. This oligomerization appears necessary for substrate release into the cytoplasm .

What is the relationship between BioY and the energy-coupling modules BioM and BioN?

The relationship between BioY and the energy-coupling modules BioMN reveals a sophisticated transport mechanism:

  • Expression analysis: When expressed together, BioM, BioN, and BioY form stable complexes in bacterial membranes. In the absence of one partner, the stability of subcomplexes varies:

    • BioMN forms stable complexes

    • BioMY and BioNY show reduced stability without the third partner

  • Functional conversion: BioMN converts BioY from a high-capacity, low-affinity transporter to a high-affinity system:

    • Solitary BioY: K<sub>m</sub> ≈ 250 nM

    • BioMNY complex: K<sub>m</sub> ≈ 5 nM

  • Energy dependence: High-affinity transport through the BioMNY complex requires ATP hydrolysis:

    • Mutation of the Walker A lysine residue in BioM (K42N) severely impairs transport

    • This demonstrates that high-affinity transport is dependent on a functional ATPase

  • Concentration-dependent activity patterns:

    • At low biotin concentrations (<10 nM): BioMNY outperforms solitary BioY

    • At high biotin concentrations (>50 nM): Solitary BioY shows higher transport rates

    • Mutation in BioM (K42N) diminishes transport activity under all conditions tested

This research reveals that BioMN modules serve as energy-coupling factors that enhance BioY's affinity for biotin through ATP-dependent mechanisms.

How is the bioY gene organized in the B. subtilis genome and how does this compare to other prokaryotes?

The genomic organization of bioY varies across prokaryotes, revealing interesting evolutionary patterns:

  • Distribution patterns:

    • Only approximately one-third of bioY genes are linked to bioMN genes

    • Many bioY genes are located at loci encoding biotin biosynthesis

    • Others are unlinked to any biotin metabolic or transport genes

  • In B. subtilis and related Bacillus species:

    • bioY may be present as a stand-alone gene

    • This suggests that BioY can function independently as a solitary transporter

    • Approximately one-third of BioY proteins are encoded in organisms lacking any recognizable T unit (energy-coupling component)

  • Comparative genomics:

    • BioMN components show similarity to homologous modules of prokaryotic transporters for metals, amino acids, and vitamins

    • These systems resemble ATP-binding cassette (ABC) transporters but notably lack extracytoplasmic solute-binding proteins

This genomic organization suggests that BioY evolved to function both independently and as part of larger transport complexes, providing flexibility in biotin acquisition strategies.

What methodologies are most effective for genetic manipulation of bioY in B. subtilis?

Several advanced genetic engineering approaches have been successfully applied to bioY manipulation in B. subtilis:

  • CRISPR-Cpf1 system:

    • Target selection: PAM sequence 5′-TTTG-3′ is preferred

    • Guide RNA design: crRNA under control of constitutive promoters (e.g., Pveg)

    • Homologous arms: 1200-bp length for precise editing

    • High efficiency: Up to 100% for gene deletions

  • Gene insertion strategies:

    • All-in-one (AIO) system: Integration efficiency around 9%

    • CRISPR-Cpf1-based CIGE (CCB-CIGE) platform: Improved efficiency up to 82%

    • Targeted integration sites: sacA locus is commonly used

  • Genetic code expansion:

    • Incorporation of non-standard amino acids using genetic code expansion systems

    • Enables click-labeling, photo-crosslinking, and translational titration

    • Can be used to introduce specific modifications to BioY for functional studies

  • For heterologous expression studies:

    • Counter-selectable marker systems and synthetic gene circuits

    • Expression of bioY with or without bioMN in E. coli transport-deficient strains

    • Use of fluorescent tags for localization and FRET studies

When manipulating bioY, researchers should consider the impact on biotin metabolism and ensure appropriate selection methods, especially when working with biotin-dependent strains.

Which amino acid residues are essential for BioY function and how can they be experimentally verified?

Critical amino acid residues in BioY have been identified through mutational analysis:

  • Key residues:

    • Asp164: Located in the sixth transmembrane helix

    • Lys167: Located in the sixth transmembrane helix

    • Both are highly conserved across BioY proteins from different species

  • Experimental approaches for verification:

    • Site-directed mutagenesis: Asp164Asn, Lys167Arg, Lys167Gln

    • Transport assays with radiolabeled biotin

    • Binding assays to distinguish between binding and transport defects

    • Structured approach using covalently linked dimers with mutations in one or both domains

  • Functional impacts of mutations:

    • In monomeric BioY: D164N and K167R mutations completely inactivate transport

    • In dimeric BioY with single domain mutations:

      • D164N and K167R reduce transport to 25% of wild-type

      • K167Q reduces transport to 75% of wild-type

    • Mutations affect the N-terminal domain more severely than the C-terminal domain

These studies reveal that the last transmembrane helix plays a crucial role in biotin recognition and transport, and that functional interactions between BioY domains from different dimers are essential for activity.

How do BioY-substrate interactions differ between the solitary state and the BioMNY complex?

The interactions between BioY and biotin differ significantly depending on whether BioY functions alone or as part of the BioMNY complex:

  • Binding and transport parameters:

    ParameterSolitary BioYBioMNY ComplexEvidence
    Affinity (K<sub>m</sub>)~250 nM~5 nMTransport assays
    Capacity (V<sub>max</sub>)HigherLowerKinetic analyses
    Energy requirementPassive/facilitatedATP-dependentWalker A mutant studies
  • Functional transitions:

    • At low biotin concentrations (<10 nM): BioMNY outperforms solitary BioY

    • At high biotin concentrations (>50 nM): Solitary BioY shows higher transport rates

    • This suggests different conformational states optimized for different environmental conditions

  • Structural implications:

    • BioMN association likely induces conformational changes in BioY

    • These changes enhance biotin binding affinity but reduce transport capacity

    • ATP hydrolysis by BioM drives these conformational changes for high-affinity transport

This dual-mode functionality provides bacteria with a flexible biotin acquisition strategy that can adapt to varying environmental biotin concentrations.

How can BioY be utilized in synthetic biology applications for B. subtilis?

BioY offers several promising applications in synthetic biology platforms using B. subtilis:

  • Biosensor development:

    • BioY-dependent growth can serve as a readout for biotin availability

    • Fluorescent-tagged BioY variants can be used to detect biotin in environmental samples

    • Expression systems linking BioY transport to reporter gene expression

  • Enhanced protein production systems:

    • Improved biotin uptake for biotinylated protein production

    • Integration with genetic code expansion systems to incorporate non-standard amino acids

    • Coupling with B. subtilis protein secretion pathways for enhanced recombinant protein yields

  • Minimal genome engineering:

    • Precise BioY manipulation using CRISPR-Cpf1 systems with up to 100% efficiency

    • Integration of optimized biotin transport systems into reduced-genome B. subtilis strains

    • Generation of biotin-dependent selection markers for synthetic biology applications

  • Design of orthogonal transport systems:

    • Engineering BioY variants with altered substrate specificity

    • Creation of genetically encoded biotin analogue transporters

    • Development of nutrient-conditional selection systems for synthetic biology circuits

These applications leverage B. subtilis' status as a model gram-positive bacterium and its advantages for industrial and research applications .

What are the methodological challenges in studying membrane protein complexes like BioY and how can they be addressed?

Studying membrane proteins like BioY presents several technical challenges that require specialized approaches:

  • Expression and purification challenges:

    • Membrane protein overexpression often leads to toxicity or inclusion body formation

    • Solution: Use of mild induction conditions, specialized expression hosts, and fusion tags

    • Example application: Expression of BioY with N-terminal His tags in E. coli transport-deficient strains has yielded functional protein

  • Structural determination difficulties:

    • Membrane proteins are notoriously difficult to crystallize

    • Solution: Modern approaches including cryo-EM, native mass spectrometry, and in-cell NMR

    • Application to BioY: Fluorescence-based techniques like FRET and anisotropy have successfully determined oligomeric states in vivo

  • Functional characterization complexities:

    • Distinguishing binding from transport requires specialized assays

    • Solution: Combination of binding assays with radiolabeled substrates and transport measurements

    • BioY-specific approaches: Comparison of wild-type and mutant BioY in heterologous hosts using [³H]biotin transport assays

  • Oligomeric state determination:

    • Detergents can disrupt native oligomeric states

    • Solution: Covalently linked dimers, cross-linking studies, and in vivo fluorescence measurements

    • BioY research example: Creation of tail-to-head linked BioY dimers with selective mutations to study domain interactions

These methodological challenges have been addressed in BioY research through careful experimental design and the application of complementary techniques, providing valuable lessons for membrane protein research more broadly.

How might the study of BioY inform our understanding of other ECF transporters?

BioY research has significant implications for understanding the broader family of ECF transporters:

  • Evolutionary relationships:

    • BioY belongs to a mechanistically novel group of membrane transporters

    • Comparative genomics reveals similarities between BioMN and modules of transporters for metals, amino acids, and vitamins

    • Research on BioY provides a template for investigating other S-components of ECF transporters

  • Mechanistic insights:

    • The ability of BioY to function both alone and in complex with BioMN provides unique insights into modular transport mechanisms

    • The dependency of high-affinity transport on ATP hydrolysis by BioM establishes a model for energy coupling in this transporter family

    • The oligomeric architecture of BioY suggests similar arrangements may exist in other S-components

  • Structural principles:

    • The essential role of transmembrane helix 6 in substrate recognition may be a conserved feature

    • The importance of specific residues (D164, K167) provides targets for investigation in other ECF transporters

    • The oligomeric organization involving dimers suggests similar arrangements may function in related systems

This research establishes a foundation for understanding the broader mechanistic principles of ECF transporters and their evolution.

What are the most promising approaches for identifying the detailed transport mechanism of BioY?

Several cutting-edge approaches hold promise for elucidating BioY's detailed transport mechanism:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy of BioY alone and in complex with BioMN

    • Time-resolved structural studies to capture transport intermediates

    • Single-particle analysis to observe conformational changes during transport

  • Incorporation of non-standard amino acids:

    • Site-specific incorporation of photocrosslinking amino acids to capture transient protein-protein interactions

    • Fluorescent non-standard amino acids for single-molecule FRET studies

    • Click-chemistry compatible amino acids for selective labeling of functional domains

  • Computational approaches:

    • Molecular dynamics simulations of BioY in membrane environments

    • QM/MM calculations to model substrate binding and transport

    • Evolutionary coupling analysis to identify co-evolving residues important for function

  • Single-molecule techniques:

    • Single-molecule transport assays using fluorescent biotin analogues

    • Patch-clamp studies of reconstituted BioY in artificial membranes

    • High-speed AFM to observe conformational dynamics during transport

  • Advanced genetic approaches:

    • CRISPR-Cpf1 systems for precise genome editing and protein engineering

    • Deep mutational scanning to comprehensively map functional residues

    • In vivo selection systems to evolve BioY variants with altered properties

The integration of these techniques promises to reveal the detailed molecular mechanism of biotin transport by BioY and related ECF transporters.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.