Recombinant Bacillus subtilis Probable capsular polysaccharide biosynthesis protein YwqC (ywqC)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

YwqC is a 248-amino-acid protein (UniProt: P96715) with two transmembrane helices and a large extracellular loop. Its cytoplasmic C-terminal domain interacts with YwqD, a protein tyrosine kinase (PTK), to enable substrate phosphorylation. Key structural features include:

  • Transmembrane domains: Critical for anchoring YwqC to the membrane.

  • C-terminal intracellular region: Facilitates interaction with YwqD and its substrates.

  • Homology: Shares structural similarity with transmembrane modulators like E. coli Wzc and Streptococcus pneumoniae CpsD .

Biochemical Functions

YwqC modulates YwqD’s kinase activity by bridging the kinase to its substrates. Key findings include:

Role in Phosphorylation

  • YwqD activation: YwqC’s C-terminal domain binds YwqD, enabling autophosphorylation at Tyr-228 and subsequent phosphorylation of UDP-glucose dehydrogenases (e.g., YwqF and TuaD) .

  • Substrate specificity: Phosphorylation of YwqF and TuaD occurs only in the presence of YwqC, activating their UDP-glucose dehydrogenase activity .

Dephosphorylation Regulation

YwqE, a tyrosine phosphatase encoded in the same operon, dephosphorylates YwqD and its substrates, terminating their activity .

Interaction Network

YwqC interacts with multiple proteins involved in polysaccharide biosynthesis and regulatory pathways:

Interacting PartnerRoleInteraction StrengthSource
YwqD (PtkA)Protein tyrosine kinase0.999STRING
YwqETyrosine phosphatase0.998STRING
YwqFUDP-glucose dehydrogenase0.905STRING
TuaDUDP-glucose dehydrogenase0.692STRING
FatRTranscriptional regulator0.773STRING

Recombinant Production and Characteristics

Recombinant YwqC is produced via heterologous expression in E. coli or yeast systems, often with His-tags for purification. Key attributes include:

Production Parameters

ParameterValueSource
Molecular Weight~27–28 kDa (GST/MBP fusions)Source
TagHis-tag, GST, or MBPSource
Purity>80% (SDS-PAGE)Source
Storage BufferPBS or Tris-based bufferSource

Applications

  • Biochemical assays: Studying YwqD/YwqC interaction kinetics.

  • Structural studies: Analyzing transmembrane domain topology.

  • Therapeutic research: Targeting capsular polysaccharide biosynthesis in pathogens .

Critical Residues and Mutational Studies

  • C-terminal domain: The last 50 amino acids are essential for YwqD interaction and substrate phosphorylation .

  • Transmembrane helices: Mutations in these regions disrupt YwqC’s membrane localization and kinase modulation .

Cross-Species Homology

YwqC homologs in Streptococcus pneumoniae (CpsD) and Staphylococcus aureus (CapB) share conserved transmembrane domains and functional roles in exopolysaccharide synthesis .

Future Directions and Challenges

  • Structural elucidation: Resolving the 3D structure of YwqC-YwqD complexes to map interaction interfaces.

  • Therapeutic targeting: Developing inhibitors to disrupt YwqC-YwqD interactions in pathogenic bacteria .

  • Systems biology: Integrating YwqC into broader regulatory networks involving serine/threonine kinases (e.g., YabT) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ywqC; BSU36260; Probable capsular polysaccharide biosynthesis protein YwqC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ywqC
Target Protein Sequence
MGESTSLKEILSTLTKRILLIMIVTAAATAAGGLISFFALTPIYENSTQILVNQSKNERK EVQFNDVQTNLQLINTYNVIIKSPAILDEVIKEMGLSMTSQELNDKITVSSEQDSQVVNI SVRDENAETAAHIANTIASVFQDKITSIMNVDNVSILSKAEVSEHPSPVSPKPLLNIAIA FAAGLAGSIGLAFLLEHLDNTIKSEEQLESLLDIPVLGTVSTIANEQKTAKTLQGFQSEK TGSGHFGA
Uniprot No.

Target Background

Function
Essential for YwqD kinase activity. It likely facilitates the interaction between YwqD and its substrates. It is also thought to be involved in regulating capsular polysaccharide biosynthesis.
Database Links
Protein Families
CpsC/CapA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic function of YwqC in Bacillus subtilis?

YwqC functions as a modulator protein for the protein tyrosine kinase (PTK) YwqD within the ywqCDEF operon in B. subtilis. This operon encodes a regulatory system involved in capsular polysaccharide biosynthesis, specifically in the UDP-glucuronate biosynthetic pathway. YwqC modulates the activity of YwqD, which phosphorylates YwqF (UDP-glucose dehydrogenase), thus regulating the production of precursors needed for capsular polysaccharide synthesis . Unlike homologous systems in pathogenic bacteria like Streptococcus pneumoniae, the B. subtilis system provides an excellent model for understanding fundamental mechanisms without the complications of virulence factors.

How does YwqC relate to capsular polysaccharide biosynthesis pathways in bacteria?

YwqC is part of a common regulatory mechanism found in many bacteria for controlling capsular polysaccharide (CPS) biosynthesis. In bacteria like Streptococcus pneumoniae, CPS is a major virulence factor, and its biosynthesis proceeds through sequential transfer of sugar residues from appropriate sugar donors to activated lipid carriers by committed glycosyltransferases . While B. subtilis is not typically pathogenic, its YwqC-containing regulatory system shares similarities with the CPS biosynthesis machinery found in pathogenic streptococci. The YwqC-YwqD-YwqE-YwqF system likely regulates the production of UDP-glucuronate, which serves as a key precursor for polysaccharide synthesis, enabling precise control over cell surface characteristics.

What is known about the structure-function relationship of YwqC?

Current structural information on YwqC is limited, but functional studies indicate it contains domains that facilitate interaction with the protein tyrosine kinase YwqD. YwqC likely possesses a membrane-associated domain and cytoplasmic regions that participate in protein-protein interactions. Based on similar systems, YwqC is believed to activate YwqD's kinase activity through direct protein-protein interactions, leading to the phosphorylation of YwqF . The exact structural mechanisms underlying this activation remain subjects of ongoing research, with current approaches focusing on structural biology techniques such as X-ray crystallography and cryo-EM to elucidate the three-dimensional organization of the YwqC-YwqD complex.

What are the optimal expression systems for recombinant YwqC production?

Several expression systems have been successfully employed for producing recombinant YwqC, with E. coli being the most commonly used heterologous host. Based on protocols used for related proteins in the same operon, the following expression system has proven effective:

Expression System Components:

  • Host strain: E. coli BL21(DE3)

  • Vector: pET-based expression vectors with N-terminal His6-tag or GST-tag

  • Induction: 1 mM IPTG during exponential growth phase

  • Expression period: 3.5 hours post-induction

For membrane-associated proteins like YwqC, specialized approaches might be necessary, such as using E. coli strains engineered for membrane protein expression or B. subtilis itself as an expression host. Recent advances in genetic code expansion in B. subtilis offer promising alternatives for producing functionally modified versions of YwqC with non-standard amino acids, allowing for click-labeling and photo-crosslinking applications .

What purification strategies are most effective for obtaining high-purity YwqC?

Based on protocols used for similar proteins in the YwqCDEF operon, the following purification strategy is recommended:

  • Cell lysis: Sonication in buffer containing 20 mM Tris-HCl (pH 7.5), 200 mM NaCl, and protease inhibitors

  • Affinity chromatography:

    • For His6-tagged YwqC: Purification using Ni-nitrilotriacetic acid agarose columns

    • For GST-tagged YwqC: Purification using glutathione Sepharose 4B resin

  • Desalting/Dialysis: Either using PD-10 columns or extensive dialysis against final buffer (typically 20 mM Tris-HCl pH 7.5, 100 mM NaCl)

  • Quality control: SDS-PAGE analysis to confirm >95% purity

For membrane-associated portions of YwqC, detergent solubilization (using mild detergents like DDM or LMNG) may be necessary during purification to maintain protein stability and functionality.

How can researchers incorporate non-standard amino acids into YwqC for functional studies?

Recent advances in genetic code expansion in B. subtilis enable the incorporation of non-standard amino acids (nsAAs) into proteins like YwqC. This approach offers powerful tools for functional studies through:

  • Click-labeling: Incorporation of azide- or alkyne-containing amino acids that allow for bioorthogonal chemistry reactions with fluorescent probes

  • Photo-crosslinking: Integration of photo-reactive amino acids that can form covalent bonds with interacting partners upon UV exposure

  • Translational titration: Precise control over protein expression levels

To implement this strategy:

  • Select an appropriate genetic code expansion system (three different families are available for B. subtilis)

  • Choose between amber stop codon (UAG) or frameshift codon suppression

  • Express the orthogonal aminoacyl-tRNA synthetase/tRNA pair alongside YwqC with the target codon at sites of interest

  • Supply the non-standard amino acid in the culture medium

This approach has been successfully demonstrated with 20 distinct non-standard amino acids in B. subtilis and can help interrogate YwqC's protein-protein interactions and functional dynamics .

What methods are available for studying YwqC's role in protein tyrosine phosphorylation?

Several complementary approaches can be employed to investigate YwqC's role in protein tyrosine phosphorylation:

In vitro kinase assays:

  • Purify recombinant YwqC, YwqD, and YwqF proteins

  • Reconstitute the system in vitro with ATP and appropriate buffers

  • Monitor phosphorylation using:

    • Western blotting with anti-phosphotyrosine antibodies

    • Radioactive ATP (γ-32P-ATP) incorporation

    • Mass spectrometry to identify phosphorylation sites

In vivo phosphorylation studies:

  • Generate B. subtilis strains with tagged versions of YwqC, YwqD, and YwqF

  • Isolate proteins under phosphorylation-preserving conditions

  • Analyze phosphorylation states using phosphoproteomic approaches

Protein-protein interaction assays:

  • Co-immunoprecipitation to detect YwqC-YwqD complexes

  • Bacterial two-hybrid systems to map interaction domains

  • Fluorescence resonance energy transfer (FRET) to visualize interactions in live cells

These approaches can be complemented with genetic methods, such as creating knockout strains or point mutations in key residues of YwqC to assess functional consequences .

How does YwqC interact with other proteins in the ywqCDEF operon?

YwqC primarily interacts with the protein tyrosine kinase YwqD, serving as its modulator. Current evidence suggests the following interaction model:

  • YwqC contains domains that bind directly to YwqD

  • This binding alters YwqD's conformation, enhancing its kinase activity

  • Activated YwqD phosphorylates YwqF (UDP-glucose dehydrogenase) on tyrosine residues

  • YwqE (protein tyrosine phosphatase) can dephosphorylate both YwqD and YwqF, providing regulatory control

The GST-YwqC-NCter construct (containing the N-terminal cytoplasmic portion of YwqC) has been successfully used to study these interactions, suggesting that the N-terminal region is particularly important for YwqD activation. Further studies using techniques such as photo-crosslinking with genetic code expansion systems can help map the precise interaction interfaces between these proteins .

What is the relationship between YwqC and the phosphatase activity of YwqE?

While YwqC does not directly interact with the phosphatase YwqE, it influences the phosphorylation state of proteins that are YwqE substrates:

  • YwqC activates the kinase YwqD, which phosphorylates target proteins (including YwqD itself and YwqF)

  • YwqE subsequently dephosphorylates these phosphotyrosine-containing proteins

  • This creates a regulatory cycle controlling the phosphorylation status of proteins involved in UDP-glucuronate biosynthesis

The balance between YwqC-activated kinase activity and YwqE phosphatase activity likely determines the net phosphorylation state of target proteins. Notably, YwqE shows specificity for the physiological substrates phosphorylated through the YwqC-YwqD system, as other B. subtilis phosphatases (YwlE and YfkJ) do not dephosphorylate these same targets, highlighting the specificity of this regulatory system .

How does the B. subtilis YwqC compare to similar proteins in pathogenic bacteria?

YwqC in B. subtilis shares functional similarities with capsular polysaccharide biosynthesis proteins in pathogenic bacteria, particularly those in Streptococcus pneumoniae, but with notable differences:

FeatureB. subtilis YwqCS. pneumoniae CpsC/CpsD system
Operon structurePart of ywqCDEF operonLocated in cps locus
Associated kinaseModulates YwqD (PTK)Modulates CpsD (PTK)
Phosphatase partnerYwqE (similar to CpsB)CpsB
SubstrateYwqF (UDP-glucose dehydrogenase)Multiple glycosyltransferases
Virulence associationNot a virulence factorDirect role in virulence
Regulatory functionControls UDP-glucuronate synthesisRegulates CPS export and assembly

While the core regulatory mechanism involving tyrosine phosphorylation is conserved, the B. subtilis system likely evolved for controlling cell envelope properties rather than virulence . This makes B. subtilis an excellent model system for studying these mechanisms without the complications associated with pathogenicity.

What insights can be gained from studying YwqC's role in capsular polysaccharide biosynthesis compared to other bacterial systems?

Comparative analysis of YwqC with related systems can reveal:

  • Evolutionary conservation: The presence of similar regulatory systems across diverse bacterial species suggests an ancient and fundamental mechanism for controlling polysaccharide synthesis.

  • Functional adaptations: While S. pneumoniae uses its CPS system for virulence, B. subtilis employs its YwqC-containing system for controlling cell envelope properties, illustrating how similar molecular machinery can be adapted for different physiological roles.

  • Regulatory principles: The YwqC system exemplifies a recurring theme in bacterial polysaccharide synthesis where protein tyrosine phosphorylation serves as a post-translational regulatory mechanism .

  • Potential antimicrobial targets: Understanding the fundamental mechanisms of these systems in non-pathogenic B. subtilis can inform the development of strategies targeting related systems in pathogenic bacteria without the biosafety concerns of working directly with pathogens.

By studying the B. subtilis YwqC system alongside CPS biosynthesis systems in organisms like S. pneumoniae, researchers can gain comprehensive insights into the molecular mechanisms governing bacterial polysaccharide production and regulation .

How can genetic code expansion be utilized to study YwqC function and interactions?

Genetic code expansion offers powerful tools for studying YwqC through the incorporation of non-standard amino acids (nsAAs) at specific positions:

  • Photo-crosslinking studies:

    • Incorporate photo-reactive amino acids (e.g., p-benzoyl-L-phenylalanine) at predicted interaction interfaces

    • UV-activate to covalently capture transient YwqC-YwqD interactions

    • Identify crosslinked residues by mass spectrometry to map binding sites

  • Site-specific labeling:

    • Insert click-chemistry-compatible nsAAs (e.g., azidophenylalanine)

    • Conjugate fluorophores for FRET studies or affinity tags for pull-down experiments

    • Track YwqC localization and dynamics in live cells

  • Translational control:

    • Engineer YwqC with nsAA dependency for expression

    • Create tunable systems where YwqC levels depend on nsAA concentration

    • Study dosage effects of YwqC on pathway regulation

B. subtilis has been demonstrated to efficiently incorporate 20 distinct nsAAs using three different genetic code expansion systems, making it an ideal platform for these advanced studies of YwqC .

What experimental approaches can be used to investigate the impact of YwqC phosphorylation on cellular physiology?

To investigate YwqC's broader physiological impacts, researchers can employ these approaches:

  • Phosphoproteomics:

    • Compare phosphoprotein profiles between wild-type and ywqC mutant strains

    • Identify downstream targets affected by YwqC-mediated phosphorylation

    • Use SILAC or TMT labeling for quantitative comparison

  • Metabolomics:

    • Analyze UDP-sugar pools and polysaccharide composition

    • Correlate changes with YwqC activity levels

    • Trace isotope-labeled precursors through biosynthetic pathways

  • Electron microscopy:

    • Examine cell envelope ultrastructure in ywqC mutants

    • Quantify changes in capsular material

    • Correlate with biochemical measurements

  • Phenotypic microarrays:

    • Test growth under hundreds of conditions

    • Identify physiological states where YwqC function is critical

    • Uncover unexpected roles beyond known functions

These approaches collectively can reveal how YwqC-mediated regulation impacts cellular physiology beyond its immediate biochemical function in the phosphorylation system .

How can structural biology approaches enhance our understanding of YwqC?

Structural biology techniques provide crucial insights into YwqC's molecular mechanisms:

These approaches, combined with computational modeling, can reveal the structural basis of YwqC's role as a modulator of YwqD kinase activity .

What are common challenges in expressing and purifying functional YwqC?

Researchers frequently encounter these challenges when working with YwqC:

  • Solubility issues:

    • YwqC contains membrane-associated regions that can cause aggregation

    • Solution: Express truncated constructs containing specific domains or use fusion tags like SUMO or MBP to enhance solubility

    • Alternative: Employ detergent solubilization protocols optimized for membrane-associated proteins

  • Co-expression requirements:

    • YwqC may require co-expression with YwqD for proper folding and stability

    • Approach: Design bicistronic constructs or dual-plasmid systems for co-expression

    • Validation: Monitor expression levels of both proteins using Western blotting

  • Functional assessment:

    • Purified YwqC may lose activity during purification

    • Testing: Develop functional assays measuring YwqC's ability to stimulate YwqD kinase activity

    • Preservation: Identify buffer conditions that maintain YwqC in its active conformation

  • Protein degradation:

    • YwqC may be susceptible to proteolysis

    • Prevention: Include protease inhibitors throughout purification

    • Monitoring: Use N- and C-terminal tags to detect truncation products by Western blotting

These challenges can be addressed through careful optimization of expression conditions and purification protocols based on the specific experimental requirements .

How can researchers distinguish between the functions of YwqC and other proteins in the ywqCDEF operon?

Distinguishing the specific functions within this interconnected system requires these approaches:

  • Genetic dissection:

    • Create single and combinatorial deletion mutants in B. subtilis

    • Complement with plasmid-expressed wild-type or mutant versions

    • Analyze phenotypic consequences of specific deletions

  • Domain swap experiments:

    • Generate chimeric proteins with domains exchanged between YwqC and related proteins

    • Test functionality in complementation assays

    • Identify domains responsible for specific functions

  • Reconstitution of minimal systems:

    • Purify individual components (YwqC, YwqD, YwqE, YwqF)

    • Reconstitute different combinations in vitro

    • Measure activities (phosphorylation, dephosphorylation) to determine requirements

  • Targeted mutagenesis:

    • Identify conserved residues in YwqC through sequence analysis

    • Create point mutations and test effects on function

    • Distinguish between direct effects and allosteric regulation

These approaches allow researchers to deconvolute the complex interplay between operon components and assign specific functions to YwqC .

What controls and validation experiments are essential when studying YwqC-mediated phosphorylation?

Rigorous controls are essential for reliable results when studying YwqC's role in phosphorylation:

  • Enzymatic controls:

    • Include kinase-dead YwqD mutants (e.g., K59M) to confirm kinase dependence

    • Use phosphatase-dead YwqE mutants to prevent dephosphorylation during analysis

    • Include non-phosphorylatable YwqF mutants (tyrosine to phenylalanine) as negative controls

  • Specificity controls:

    • Test other B. subtilis phosphatases (YwlE, YfkJ) to confirm pathway specificity

    • Include unrelated proteins to rule out non-specific phosphorylation

    • Use mass spectrometry to confirm exact phosphorylation sites

  • System validation:

    • Correlate in vitro biochemical results with in vivo phenotypes

    • Verify protein-protein interactions through multiple independent methods

    • Demonstrate physiological relevance through phenotypic analysis of mutants

  • Technical controls:

    • Use multiple antibodies or detection methods for phosphotyrosine

    • Include phosphorylation time courses to capture dynamics

    • Validate recombinant protein activity through functional assays

These controls ensure that observed effects are specifically attributed to YwqC's modulation of the phosphorylation system rather than experimental artifacts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.