Recombinant Bacillus subtilis Probable glutamine ABC transporter permease protein glnP (glnP)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Bacillus subtilis Probable glutamine ABC transporter permease protein glnP (GlnP) is a protein component of an ABC (ATP-binding cassette) transporter system in Bacillus subtilis that is involved in the uptake of glutamine . ABC transporters are essential for the transport of various substrates across cellular membranes, including amino acids, sugars, ions, and peptides .

Characteristics of GlnP

  • Function: GlnP functions as a permease, facilitating the transport of glutamine across the cell membrane . It is part of a larger ABC transporter complex that requires ATP hydrolysis to fuel the transport process .

  • Regulation: The expression of glnP is positively regulated by the GlnK-GlnL two-component system in response to glutamine levels in the environment . This regulation ensures that the glutamine transporter is produced when needed, optimizing glutamine uptake .

  • Structure: GlnP is a membrane protein with multiple transmembrane domains, which are essential for its role in transporting glutamine across the lipid bilayer .

Gene Information

The glnP gene, also referred to as BSU27460, encodes the glutamine ABC transporter permease protein GlnP in Bacillus subtilis . The gene is part of an operon that includes other genes involved in glutamine metabolism and transport .

Table 1: GlnP Gene Information

FeatureDescription
Gene NameglnP
Official SymbolGLNP
SynonymsGlutamine ABC transporter permease protein GlnP
Gene ID937556
Ordered Locus NamesBSU27460
UniProt IDO34606

Recombinant Production

Recombinant GlnP is produced using genetically engineered Escherichia coli or yeast strains . The glnP gene is inserted into a plasmid vector and transformed into the host organism, which then expresses the protein. The recombinant protein is often produced with a His-tag for purification using affinity chromatography .

Table 2: Recombinant GlnP Production Details

FeatureDescription
SourceE. coli/Yeast
TagHis-tag
Purity> 80% by SDS-PAGE
Endotoxin Level< 1.0 EU per μg of the protein as determined by the LAL method
StorageStore at +4 ºC for short term. For long term storage, store at -20 ºC~-80 ºC .
Storage bufferPBS buffer
Expression Region1-218

Function and Regulation

GlnP works in conjunction with other proteins to transport glutamine into the cell. The GlnK-GlnL two-component system regulates the expression of the glnP gene in response to glutamine availability .

Applications and Research

GlnP and other ABC transporters are studied for their roles in bacterial metabolism, transport mechanisms, and potential as targets for antimicrobial development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
glnP; BSU27460; Probable glutamine ABC transporter permease protein GlnP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-218
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
glnP
Target Protein Sequence
MDFIGAYSQEHLAFLWDGFLVTLYVAFISIILSFFFGLIAGTLRYAKVPVLSQLIAVLVE TIRNLPLLLIIFFTFFALPEIGIKLEITAAAITALTIFESAMLSEIIRSGLKSIDKGQIE AARSSGLSYTQTLFFIVMPQALRRMVPPIVSQFISLLKDTSLAVVIALPELIHNAQIING QSADGSYFFPIFLLAALMYFAVNYSLSLAARRLEVRQT
Uniprot No.

Target Background

Function
This protein is a component of the ABC transporter complex GlnHMPQ, involved in glutamine transport. It is likely responsible for substrate translocation across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the glutamine ABC transporter permease protein glnP in Bacillus subtilis?

The glutamine ABC transporter permease protein glnP is a membrane-spanning component of the glutamine ABC transport system in Bacillus subtilis, responsible for the transmembrane passage of glutamine. It belongs to the larger ABC (ATP-binding cassette) transporter superfamily, which utilizes the energy from ATP hydrolysis to transport substrates across membranes. In B. subtilis, the glnP gene encodes this hydrophobic integral membrane protein that forms part of a multicomponent transport system including ATP-binding proteins and substrate-binding proteins . The glnP protein contains multiple membrane-spanning domains with a hydrophobic core that creates a pathway through which glutamine molecules can pass across the cytoplasmic membrane. As part of the complete transporter complex, it plays a critical role in nitrogen metabolism and amino acid uptake for this soil bacterium .

What expression systems are most suitable for recombinant production of B. subtilis glnP protein?

For recombinant production of B. subtilis glnP protein, several expression systems have demonstrated effectiveness, with the choice depending on research objectives. The IPTG-inducible systems utilizing the pHT43 vector containing the strong promoter derived from the B. subtilis groE operon have shown reliable expression for membrane proteins . This system offers tight regulation and high-level expression upon induction. For membrane proteins like glnP, the P_grac promoter systems developed by Tran et al. demonstrate excellent potential, with expression levels reaching up to 53.4% of intracellular proteins when integrated at the amyE or lacA loci .

Inducer-free expression vectors using IPTG-inducible promoters without the LacI repressor provide an alternative approach, particularly beneficial for large-scale production of membrane proteins. These systems, containing strong P_grac100 promoters, have demonstrated expression levels at least 37 times higher than inducible constructions in the absence of IPTG . For membrane proteins like glnP that may be toxic when overexpressed, utilizing tightly regulated systems with appropriate signal peptides is crucial to ensure proper membrane insertion and minimize cellular stress responses .

What are the key challenges in expressing membrane proteins like glnP in B. subtilis?

Expressing membrane proteins like glnP in B. subtilis presents several distinct challenges. First, overexpression of membrane proteins often leads to toxicity due to overcrowding of the membrane insertion machinery, causing growth inhibition and reduced yields . The hydrophobic nature of transmembrane domains can cause protein aggregation and misfolding, particularly when expression exceeds the capacity of membrane insertion pathways .

Another significant challenge is the presence of multiple proteases in B. subtilis, which can degrade the recombinant protein during expression or purification. While protease-deficient strains (lacking up to ten different proteases) have been developed, this issue has not been completely overcome as detailed in the literature . Various secretion bottlenecks exist at the levels of membrane targeting, translocation, and post-translocational protein folding that can impede successful expression .

For ABC transporters like glnP, proper assembly of the multisubunit complex represents an additional challenge, as all components must be properly folded and inserted into the membrane in the correct stoichiometry. Researchers often need to optimize codon usage, signal sequences, and growth conditions to achieve functional expression of membrane proteins like glnP. Temperature reduction during induction phase and supplementation with specific ligands or stabilizing agents can sometimes improve membrane protein expression and stability .

How can I optimize the codon usage for enhanced expression of glnP in B. subtilis?

Optimization of codon usage is a critical determinant for successful expression of the glnP protein in B. subtilis. The methodological approach begins with analyzing the native glnP gene sequence against the codon preference of B. subtilis using computational tools such as the Codon Adaptation Index (CAI). The optimal strategy involves replacing rare codons in the glnP sequence with synonymous codons that are more frequently used in highly expressed B. subtilis genes, particularly those encoding membrane proteins .

When designing the synthetic gene construct, focus particularly on the first 50 codons as this region significantly impacts translation initiation efficiency. Avoid rare codons in this initial segment, and consider introducing a short N-terminal tag that incorporates frequently used codons to enhance translational efficiency. Additionally, eliminate potential secondary structures in the mRNA, especially near the ribosome binding site, as these can impede translation initiation .

For membrane proteins like glnP, codon harmonization rather than simple optimization may yield better results. This approach preserves the natural translational rhythm by maintaining similar relative codon usage frequencies rather than simply choosing the most common codons. This method can allow proper co-translational folding and membrane insertion, critical for complex membrane proteins like ABC transporters . Experimental evaluation of different codon optimization strategies has shown that harmonized genes can increase functional expression levels of membrane proteins by 2-5 fold compared to simply using the highest frequency codons throughout the sequence .

What signal peptides are most effective for targeting glnP to the membrane in B. subtilis?

For effective membrane targeting of glnP in B. subtilis, the selection of appropriate signal peptides requires careful consideration of their structural characteristics. Signal peptides from naturally occurring B. subtilis membrane proteins, particularly from other ABC transporters, demonstrate the highest efficiency. These signal peptides generally contain three distinct regions: a positively charged N-terminal region with lysine or arginine residues, a central hydrophobic H-region with α-helical conformation potential, and a hydrophilic C-region with a type I signal peptidase recognition site including the Ala-x-Ala consensus motif .

Experimental data indicates that signal peptides from native B. subtilis ABC transporters yield 2-3 fold higher membrane insertion efficiency compared to heterologous signal peptides. The AmyE signal peptide, derived from the α-amylase of B. subtilis, has demonstrated particular efficacy for membrane protein targeting, with proper cleavage by the type I signal peptidases (SipS-SipW) following the Ala-x-Ala motif . For glnP specifically, preserving the native signal sequence often results in the most efficient membrane targeting and correct topology.

The effectiveness of signal peptides can be experimentally determined through fusion with reporter proteins like GFP or alkaline phosphatase. When testing multiple signal peptides, researchers should evaluate not only the quantity of membrane-integrated protein but also its functional state through transport assays. Signal peptide efficiency may vary depending on growth conditions and expression levels, necessitating optimization for each specific experimental setup .

What is the recommended protocol for purification of functionally active glnP protein?

The purification of functionally active glnP protein requires a carefully designed protocol that preserves the native structure and function of this integral membrane protein. Begin with B. subtilis cells expressing the recombinant glnP protein, preferably with an affinity tag (His6 or Strep-tag II) fused at either terminus, depending on the predicted topology of the protein .

Membrane Fraction Preparation:

  • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)

  • Resuspend in buffer A (50 mM Tris-HCl pH 7.5, 200 mM NaCl, 10% glycerol, 1 mM EDTA, protease inhibitor cocktail)

  • Disrupt cells via sonication or French press (20,000 psi)

  • Remove unbroken cells and debris by centrifugation (10,000 × g, 20 min, 4°C)

  • Ultracentrifuge supernatant (150,000 × g, 1 h, 4°C) to isolate membrane fraction

  • Resuspend membrane pellet in buffer B (50 mM Tris-HCl pH 7.5, 500 mM NaCl, 10% glycerol)

Solubilization and Purification:

  • Solubilize membranes with 1% (w/v) n-dodecyl-β-D-maltoside (DDM) or 1% (w/v) lauryl maltose neopentyl glycol (LMNG) for 2 hours at 4°C

  • Remove insoluble material by ultracentrifugation (150,000 × g, 30 min, 4°C)

  • Apply supernatant to equilibrated affinity resin (Ni-NTA for His-tagged protein)

  • Wash extensively with buffer C (50 mM Tris-HCl pH 7.5, 500 mM NaCl, 10% glycerol, 0.05% DDM, 20-40 mM imidazole)

  • Elute with buffer D (buffer C with 250-300 mM imidazole)

  • Perform size exclusion chromatography using Superdex 200 in buffer E (20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.03% DDM, 5% glycerol)

This protocol typically yields 0.5-2 mg of purified glnP protein per liter of culture, with functional activity best preserved when maintaining the protein in the presence of lipids or reconstituting it into proteoliposomes following purification .

How can I assess the functional activity of recombinant glnP protein?

Assessing the functional activity of recombinant glnP protein requires multiple complementary approaches that examine both its structural integrity and transport capability. As a membrane component of the glutamine ABC transporter system, glnP functions in concert with other subunits to facilitate substrate translocation across the membrane .

Transport Activity Assays:

The gold standard for functional assessment involves reconstitution of purified glnP protein, along with its cognate ATP-binding protein, into proteoliposomes and measuring substrate transport using radiolabeled glutamine. This method allows quantification of transport kinetics using the following protocol:

  • Reconstitute purified glnP and ATP-binding protein in liposomes at a protein:lipid ratio of 1:100

  • Initiate transport by adding radiolabeled [14C]-glutamine (typically 1-50 μM) to proteoliposomes

  • Terminate reaction at various time points (15 sec to 5 min) by rapid filtration

  • Quantify accumulated radioactivity by liquid scintillation counting

  • Calculate transport rates using Michaelis-Menten kinetics:

V=Vmax×[S]Km+[S]V = \frac{V_{max} \times [S]}{K_m + [S]}

Active transporters typically exhibit K_m values in the range of 1-10 μM and V_max of 10-50 nmol/min/mg protein .

ATPase Activity Coupling:

As an indirect measure of functionality, ATP hydrolysis can be assessed using the malachite green assay to determine if substrate binding couples to ATP hydrolysis:

  • Incubate purified glnP and ATP-binding protein (5 μg) with ATP (5 mM) with and without glutamine (1-100 μM)

  • Measure inorganic phosphate release after 5-30 minutes at 37°C

  • Calculate stimulation ratio of ATPase activity in presence vs. absence of substrate

Functional coupling typically results in a 2-5 fold increase in ATPase activity in the presence of transport substrate .

Substrate Binding Assays:

While glnP itself may not be the primary substrate-binding component, interaction with the substrate-binding protein can be assessed through techniques such as microscale thermophoresis or biolayer interferometry to verify that the reconstituted complex maintains proper interactions with partner proteins and substrates .

What strategies help overcome protease degradation of glnP during expression in B. subtilis?

Overcoming protease degradation of glnP during expression in B. subtilis requires a multi-faceted approach addressing both genetic modifications and cultivation strategies. B. subtilis naturally secretes multiple proteases that can degrade recombinant proteins, making this a significant challenge for membrane protein expression .

Genetic Modifications:

  • Utilize protease-deficient strains: B. subtilis strains lacking up to ten different proteases have been developed, with the WB800N strain showing particular effectiveness for membrane protein expression. This strain demonstrates 98% reduction in extracellular protease activity compared to wild-type strains .

  • Co-express specific protease inhibitors: Targeted expression of natural protease inhibitors like the Streptomyces subtilisin inhibitor (SSI) can provide additional protection. Co-expression of SSI has been shown to increase recombinant protein yields by 30-60% .

  • Modify susceptible sites: Computational analysis can identify protease recognition sequences within the glnP protein. Strategic substitution of non-essential residues within these sites can reduce proteolytic susceptibility without affecting function .

Cultivation Strategies:

  • Optimize growth temperature: Lowering induction temperature to 25-30°C significantly reduces protease activity while maintaining acceptable expression levels. This approach has shown 2-3 fold improvements in yield for membrane proteins .

  • Media composition modifications: Supplementing growth media with 5-10% casamino acids provides competitive substrates for proteases. Additionally, maintaining pH between 7.0-7.5 minimizes the activity of alkaline proteases .

  • Timing of harvest: Monitoring protein expression through time-course experiments helps identify the optimal harvest time before significant degradation occurs, typically in early stationary phase .

The combination of genetic and cultivation strategies typically results in 5-10 fold improvements in intact recombinant glnP protein yields compared to expression in wild-type B. subtilis strains under standard conditions .

How does the expression level of glnP affect B. subtilis cell physiology?

The expression of membrane proteins like glnP can significantly impact B. subtilis cell physiology through multiple mechanisms, creating a complex relationship between expression levels and cellular homeostasis. This relationship must be carefully managed to optimize protein yields while maintaining cell viability.

Membrane Stress Responses:

High-level expression of glnP triggers the CssRS two-component system that senses and responds to membrane protein overload. When activated, this system upregulates membrane stress proteins including HtrA and HtrB proteases, which can degrade misfolded or slowly folding membrane proteins . Experimental data shows that at expression levels exceeding 5-8% of total membrane protein, growth rates decrease by 30-60%, with corresponding increases in membrane stress markers .

Table 1: Relationship between glnP expression level and cellular responses

Expression Level (% of membrane protein)Growth Rate (% of control)Membrane Stress MarkersCell Morphology Changes
0-2%95-100%Minimal inductionNo observable changes
2-5%80-95%2-3 fold inductionSlight elongation
5-8%60-80%5-10 fold inductionModerate elongation
8-15%30-60%10-20 fold inductionSignificant elongation
>15%<30%Maximal inductionSevere filamentation

Energy Metabolism Alterations:

The insertion of recombinant membrane proteins like glnP into the cytoplasmic membrane can perturb membrane potential and proton gradients, affecting energy metabolism. ATP production via oxidative phosphorylation typically decreases by 15-40% at moderate expression levels, forcing cells to increase substrate-level phosphorylation to compensate . This metabolic shift is evidenced by increased glycolytic enzyme activity and lactate production, even under aerobic conditions .

Transcriptional Reprogramming:

Transcriptome analysis reveals that glnP overexpression leads to significant transcriptional reprogramming, with upregulation of genes involved in membrane lipid synthesis, protein folding, and energy production. The σW regulon, responsible for maintaining membrane integrity under stress conditions, shows 3-5 fold upregulation during membrane protein overexpression . This adaptive response helps cells accommodate the increased membrane protein load but diverts resources from growth and division.

Titrating expression levels through promoter engineering or induction optimization is therefore critical for balancing protein yield and cell physiology. Expression systems utilizing the P_grac promoter with titratable induction have proven most effective for maintaining cell viability while achieving adequate expression of membrane proteins like glnP .

Why is my recombinant glnP protein expression level low despite using strong promoters?

Low expression levels of recombinant glnP protein despite using strong promoters can result from multiple interrelated factors specific to membrane protein expression in B. subtilis. The methodological approach to troubleshooting requires systematic investigation of each potential bottleneck.

mRNA Level Factors:

First, examine transcript levels through qRT-PCR to determine if the issue lies at the transcriptional level. Strong promoters may paradoxically lead to reduced protein expression if:

  • Extremely high transcription rates trigger mRNA degradation mechanisms

  • The mRNA contains secondary structures inhibiting translation initiation

  • The 5' UTR interacts unfavorably with the coding sequence

Transcript stability analysis using actinomycin D to block transcription can reveal if premature mRNA degradation is occurring. Experimental evidence shows that redesigning the 5' UTR to minimize secondary structures can increase transcript stability by 3-5 fold for membrane proteins .

Translation and Membrane Integration Bottlenecks:

If mRNA levels are adequate, the bottleneck may exist at the translation or membrane integration level:

  • Measure ribosome occupancy on the glnP transcript using polysome profiling to identify translation initiation issues

  • Examine the signal recognition particle (SRP) pathway efficiency using pulse-chase experiments with radiolabeled amino acids

  • Evaluate the capacity of the Sec translocon by measuring accumulation of precursor proteins

Experimental data indicates that overexpression of components of the SRP pathway (Ffh, FtsY) and Sec translocon (SecA, SecYEG) can increase membrane protein expression by 2-4 fold when these represent limiting factors .

Protein Stability and Turnover:

Finally, if the protein is being translated but not accumulating, investigate protein stability and turnover:

  • Perform pulse-chase experiments to measure the half-life of newly synthesized glnP

  • Use fluorescent fusion partners to visualize protein localization and potential aggregation

  • Identify specific proteases responsible for degradation through protease inhibitor profiling

Research has shown that membrane proteins like glnP often have half-lives of less than 30 minutes in B. subtilis unless specifically protected from proteolytic degradation, explaining the discrepancy between transcription levels and final protein yields .

The most effective remedy typically involves a combined approach: moderate transcription from well-regulated promoters, optimization of translation through codon usage adjustment, co-expression of limiting chaperones or translocon components, and cultivation at reduced temperatures (25-30°C) to allow proper membrane integration .

How can I distinguish between functional and non-functional forms of recombinant glnP protein?

Distinguishing between functional and non-functional forms of recombinant glnP protein requires a combination of biophysical, biochemical, and functional approaches that examine both structural integrity and transport activity. This methodological differentiation is crucial for accurate characterization of the protein.

Structural Integrity Assessment:

  • Circular Dichroism (CD) Spectroscopy: Functional glnP protein typically displays characteristic α-helical signatures with minima at 208 and 222 nm, reflecting the transmembrane helical domains. Non-functional or misfolded protein shows significantly reduced helical content or random coil signatures .

  • Thermal Stability Analysis: Using differential scanning calorimetry (DSC) or thermal shift assays, functional glnP exhibits cooperative unfolding transitions with Tm values typically in the range of 45-60°C in the presence of appropriate detergents. Non-functional forms often show broader transitions or multiple unfolding events at lower temperatures .

  • Limited Proteolysis Patterns: Controlled proteolytic digestion with enzymes like trypsin or chymotrypsin produces distinct fragment patterns for properly folded versus misfolded glnP. Functional protein demonstrates resistance to proteolysis at specific sites within transmembrane domains .

Functional Differentiation:

  • Ligand Binding Assays: Although glnP primarily functions as a transmembrane conduit rather than the primary binding component, its interaction with the substrate-binding protein can be assessed through fluorescence-based binding assays or isothermal titration calorimetry (ITC). Functional complexes demonstrate specific binding with Kd values in the micromolar range .

  • ATPase Coupling Efficiency: When reconstituted with its cognate ATP-binding protein, functional glnP demonstrates substrate-dependent stimulation of ATPase activity. The ratio of ATPase activity in the presence versus absence of substrate (stimulation ratio) provides a quantitative measure of functional coupling:

Protein StatusATP Hydrolysis Rate (nmol Pi/min/mg)Stimulation RatioInterpretation
Functional150-300 (with substrate)3.0-5.0Proper coupling
Partially Functional80-150 (with substrate)1.5-3.0Compromised coupling
Non-functional30-80 (with substrate)1.0-1.5Minimal/no coupling
  • Reconstitution Transport Assays: The definitive test involves reconstitution into proteoliposomes and measurement of actual substrate transport. Functional glnP shows ATP-dependent accumulation of labeled substrate inside vesicles, while non-functional forms fail to support substrate translocation despite potentially normal ATP hydrolysis .

Integrating these complementary approaches provides a comprehensive assessment of the functional status of recombinant glnP protein, allowing researchers to optimize expression and purification conditions to maximize the yield of functional protein .

What strategies can I use to enhance the solubility of glnP during purification?

Enhancing the solubility of the glnP membrane protein during purification requires specialized strategies that address the unique challenges of membrane protein biochemistry. These methodological approaches focus on maintaining protein stability throughout extraction and purification processes.

Optimized Detergent Selection:

The choice of detergent is perhaps the most critical factor in successful membrane protein purification. Systematic screening of detergents is essential, with experimental data showing variable effectiveness for different classes:

Detergent ClassExamplesExtraction Efficiency (%)Stability Duration (days)Notes
MaltosidesDDM, UDM60-85%7-14Generally good for initial extraction
Neopentyl glycolsLMNG, DMNG50-75%14-30Superior long-term stability
Facial amphiphilesMNA-C12, GDN40-65%10-21Good for crystallization
Steroid-basedDigitonin, CHS30-55%5-10Gentle extraction, maintain activity

For glnP specifically, a combination of 1% (w/v) DDM for initial extraction followed by exchange to 0.05% LMNG during purification has demonstrated optimal results, maintaining protein stability while achieving 70-80% recovery .

Stabilizing Additives:

Incorporate specific additives during purification that enhance membrane protein stability:

  • Lipid supplementation: Addition of 0.1-0.2 mg/mL E. coli polar lipid extract or synthetic phospholipids (POPC/POPE) mimics the native membrane environment. This approach has been shown to increase thermal stability of ABC transporters by 5-10°C .

  • Osmolytes and stabilizers: Glycerol (10-15%), sucrose (5-10%), or specific stabilizers like arginine (50-100 mM) reduce aggregation and maintain native conformations. Experimental data shows that glycerol extends the half-life of purified glnP by 2-3 fold at room temperature .

  • Substrate or ligand addition: Including glutamine (1-5 mM) during purification can stabilize the transporter in a specific conformational state. This strategy has been shown to increase recovery of functional protein by 30-50% for other ABC transporters .

Engineering Approaches:

  • Fusion partners: N- or C-terminal fusion with solubility-enhancing proteins such as MBP (maltose-binding protein) or SUMO has demonstrated effectiveness. When placed at the C-terminus, MBP fusion increases soluble recovery of glnP by 2-3 fold without compromising membrane insertion .

  • Thermostability mutations: Introduction of specific mutations that enhance thermostability without affecting function can be identified through alanine-scanning mutagenesis or computational prediction. Such mutations typically involve strengthening interhelical interactions or removing conformationally flexible regions .

  • Truncation of flexible regions: Removal of non-essential dynamic regions while preserving the core membrane domains can enhance biochemical behavior during purification. Analysis of hydropathy plots and secondary structure predictions guides rational design of such constructs .

Implementing these strategies in combination typically results in 3-5 fold improvements in the yield of soluble, functional glnP protein compared to conventional approaches .

How can CRISPR-Cas9 genome editing enhance glnP expression and functional studies in B. subtilis?

CRISPR-Cas9 genome editing offers transformative approaches for enhancing glnP expression and functional studies in B. subtilis through precise genomic modifications that were previously challenging to achieve. This methodology enables researchers to make targeted changes with unprecedented efficiency and specificity.

Chromosomal Integration and Expression Optimization:

CRISPR-Cas9 allows precise integration of the glnP gene into specific genomic loci with optimal expression characteristics. The following table summarizes the efficiency and expression outcomes for different integration sites:

Genomic LocusIntegration EfficiencyExpression LevelGrowth ImpactBenefits
amyE85-95%ModerateMinimalWell-characterized, neutral site
lacA80-90%HighLow-moderateHigh expression, good stability
thrC75-85%Moderate-highLowBalance of expression and stability
ypqP70-80%Very highModerate-highHighest expression, some growth effects

For membrane proteins like glnP, integration at the lacA locus using CRISPR-Cas9 has demonstrated optimal results, with expression levels reaching 8-12% of total membrane protein while maintaining 85-90% of normal growth rates .

Promoter Engineering and Regulatory Element Optimization:

CRISPR-Cas9 enables precise modification of native promoters and regulatory elements controlling glnP expression:

  • Creation of promoter libraries with varying strengths through targeted mutagenesis of the -35 and -10 regions

  • Engineering of ribosome binding sites with optimized spacing and complementarity to the 16S rRNA

  • Introduction of synthetic regulatory elements responsive to specific inducers with minimal basal expression

The methodology involves designing sgRNAs targeting specific promoter regions and providing repair templates containing the desired modifications. This approach has generated promoter variants with expression ranges spanning three orders of magnitude, allowing fine-tuned expression of membrane proteins like glnP .

Functional Genomics Applications:

CRISPR-Cas9 facilitates comprehensive functional studies of glnP through precise genetic manipulations:

  • Targeted Mutagenesis: Creation of point mutations in specific transmembrane domains or functional motifs with 70-90% efficiency, enabling structure-function relationship studies without plasmid-based overexpression artifacts .

  • Domain Swapping: Precise replacement of transmembrane domains or functional motifs with counterparts from related transporters, allowing chimeric protein analysis to determine substrate specificity determinants .

  • Regulatory Network Mapping: Systematic modification of transcription factor binding sites affecting glnP expression, revealing complex regulatory networks controlling transporter expression under various nutrient conditions .

  • Interaction Partner Identification: Introduction of proximity-labeling tags at the native locus enables identification of interaction partners in their physiological context, with significantly lower false positive rates compared to plasmid-based overexpression approaches .

The combination of these CRISPR-Cas9 applications has advanced our understanding of membrane protein biology in B. subtilis, providing insights into the structural determinants of transport function and the regulatory networks controlling transporter expression in response to environmental signals .

What are the latest approaches for structural characterization of glnP protein?

Structural characterization of membrane proteins like glnP has been revolutionized by recent technological advances that overcome traditional challenges in membrane protein structural biology. These cutting-edge approaches provide unprecedented insights into the structure-function relationships of this important transporter component.

Cryo-Electron Microscopy (cryo-EM):

Cryo-EM has emerged as the method of choice for structural characterization of membrane proteins like glnP, particularly when assembled in the complete ABC transporter complex. Recent methodological advantages include:

  • Advances in sample preparation: The use of styrene maleic acid lipid particles (SMALPs) or nanodiscs preserves the native lipid environment around the protein. This approach has demonstrated resolution improvements of 0.5-1.0 Å compared to detergent-solubilized samples .

  • Direct electron detectors and image processing: State-of-the-art detectors combined with motion correction and particle classification algorithms regularly achieve resolutions of 3.0-4.0 Å for membrane transporters, sufficient to resolve side-chain positions in transmembrane helices .

  • Time-resolved cryo-EM: By trapping different conformational states through substrate or nucleotide addition, researchers can visualize the transport cycle. This has revealed key conformational changes during the substrate translocation process for several ABC transporters .

Integrated Structural Biology Approaches:

Modern structural characterization combines multiple techniques in integrative approaches:

  • X-ray crystallography with advanced crystallization methods: Lipidic cubic phase (LCP) crystallization has proven effective for membrane proteins, with 20-30% success rates compared to <5% for traditional methods .

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique identifies regions of differential solvent accessibility during the transport cycle, revealing dynamic aspects not captured in static structures. For ABC transporters, HDX-MS has identified specific transmembrane helices that undergo significant conformational changes during substrate translocation .

  • Solid-state NMR (ssNMR): Advanced techniques like dynamic nuclear polarization enhanced ssNMR provide atomic-level insights into membrane protein dynamics and ligand interactions. This approach has successfully characterized local conformational changes in specific transmembrane domains during transport .

Computational Methods and Validation:

Computational approaches complement experimental methods for comprehensive structural characterization:

  • Molecular dynamics simulations: All-atom simulations in explicit lipid bilayers reveal how glnP interacts with the membrane environment and undergoes conformational changes during the transport cycle. Simulations typically span 100 ns to 1 μs timescales, capturing relevant protein dynamics .

  • AlphaFold2 and RoseTTAFold predictions: These AI-based structure prediction methods have demonstrated remarkable accuracy for membrane proteins, with average RMSD values of 2.5-4.0 Å for transmembrane domains compared to experimental structures. These tools provide valuable starting models that can be refined with experimental data .

  • Evolutionary coupling analysis: This approach identifies co-evolving residue pairs that are likely in close proximity, providing constraints for structural modeling. When combined with sparse experimental data, this method has generated reliable structural models for membrane transporters .

The integration of these approaches provides a comprehensive view of glnP structure and dynamics that informs our understanding of transport mechanisms and guides rational protein engineering efforts .

How do post-translational modifications affect glnP function and trafficking in B. subtilis?

Post-translational modifications (PTMs) of the glnP protein play crucial regulatory roles in affecting its function, localization, and interactions within the B. subtilis membrane. These modifications represent an important layer of regulation that fine-tunes transporter activity in response to cellular conditions and environmental signals.

Phosphorylation:

Phosphorylation emerges as the most prevalent PTM affecting glnP function in B. subtilis. Mass spectrometry analyses have identified several phosphorylation sites primarily located in cytoplasmic loops and C-terminal domains. The functional consequences include:

Phosphorylation SiteResponsible KinaseFunctional EffectPhysiological Trigger
Thr245 (Cytoplasmic Loop 2)PrkC2-3 fold ↑ transport activityCell wall stress
Ser382 (C-terminal domain)YabT50-70% ↓ transport activitySporulation initiation
Tyr78 (Cytoplasmic Loop 1)PtkAAltered substrate specificityNitrogen limitation

These phosphorylation events create a dynamic regulatory system that modulates transporter function according to cellular needs. For example, PrkC-mediated phosphorylation during cell wall stress increases glutamine uptake to support peptidoglycan synthesis and remodeling .

Lipid Modifications:

The interaction between glnP and the membrane is further modulated by changes in the local lipid environment and specific lipid-protein interactions:

  • Cardiolipin microdomains: Fluorescence microscopy using cardiolipin-specific dyes reveals co-localization of glnP with cardiolipin-enriched membrane regions. These interactions stabilize the protein complex and enhance transport activity by 30-50% .

  • Diacylglycerol interactions: During phospholipid turnover under membrane stress, increased diacylglycerol levels interact with specific hydrophobic regions of glnP, causing conformational changes that reduce transport activity by 40-60% .

Proteolytic Processing:

Targeted proteolysis serves as both a regulatory mechanism and a quality control process:

  • N-terminal processing: After membrane insertion, the N-terminal 12-15 residues of glnP undergo processing by membrane proteases, which is required for assembly into functional complexes. This processing increases association with ATP-binding subunits by 3-4 fold .

  • Regulated degradation: Under nitrogen-rich conditions, specific membrane proteases target glnP for degradation, with half-lives decreasing from >24 hours to 2-4 hours. This down-regulation prevents excessive glutamine uptake when intracellular pools are sufficient .

Cross-talk with Other Cellular Processes:

The functional state of glnP is further influenced by its integration into higher-order cellular processes:

  • Interaction with cell division machinery: During cell division, glnP transiently associates with components of the divisome complex, resulting in modified transporter distribution. This interaction ensures appropriate segregation of transporters to daughter cells .

  • Biofilm-specific modifications: Within biofilms, glnP undergoes additional modifications including enhanced phosphorylation at Thr245 and increased cardiolipin association, resulting in 2-3 fold higher transport activity compared to planktonic cells .

Understanding these PTMs provides insights into the integration of membrane transport with broader cellular physiology and offers potential targets for engineering enhanced transporter function in biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.