Recombinant Bacillus subtilis Probable polysaccharide biosynthesis protein epsC (epsC)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Bacillus subtilis EpsC is a genetically engineered protein involved in the biosynthesis of exopolysaccharides (EPS), critical for biofilm formation, colony architecture, and environmental adaptation in B. subtilis. EpsC is encoded by the epsC gene within the epsA–O operon and functions as a UDP-GlcNAc 4,6-dehydratase, playing a pivotal role in synthesizing N,N′-diacetylbacillosamine (QuiNAc4NAc), a rare sugar monomer essential for EPS assembly .

Functional Role in EPS Biosynthesis

EpsC operates within a conserved pathway alongside EpsM (acetyltransferase) and EpsN (aminotransferase) to synthesize QuiNAc4NAc, which serves as the first monosaccharide in the B. subtilis EPS chain . Key steps include:

  1. Dehydration: EpsC converts UDP-GlcNAc to UDP-4-keto-6-deoxy-GlcNAc .

  2. Amination: EpsN adds an amino group to form UDP-4-amino-4,6-dideoxy-GlcNAc .

  3. Acetylation: EpsM acetylates the intermediate to yield UDP-QuiNAc4NAc .

Table 2: Comparative Analysis of EpsC Homologs

OrganismHomologFunctionIdentity to EpsC
Campylobacter jejuniPglFUDP-GlcNAc 4,6-dehydratase54%
Neisseria gonorrhoeaeLgtBGlycosyltransferase32%

Industrial and Biomedical Relevance

  • Biofilm Engineering: EPS matrices containing QuiNAc4NAc enhance biofilm robustness, relevant for industrial fermentation and probiotic formulations .

  • Therapeutic Potential: B. subtilis EPS exhibits anti-inflammatory properties, with recombinant EpsC enabling targeted modulation of EPS composition .

Challenges and Future Directions

  • Structural Insights: Full-length EpsC’s transmembrane domain remains uncharacterized, necessitating cryo-EM studies .

  • Biotechnological Optimization: Engineering EpsC for improved catalytic efficiency could advance synthetic biology applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
epsC; yveM; BSU34350; Probable polysaccharide biosynthesis protein EpsC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-598
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
epsC
Target Protein Sequence
MIIALDTYLVLNSVIAGYQFLKDSYQFYDSGALLLTAVSLLLSYHVCAFLFNQYKQVWTY TGLGELIVLLKGITLSAAVTGVIQYAVYHTMFFRLLTACWVLQLLSIGGTRILSRVLNES IRKKRCASSRALIIGAGSGGTLMVRQLLSKDEPDIIPVAFIDDDQTKHKLEIMGLPVIGG KESIMPAVQKLKINYIIIAIPSLRTHELQVLYKECVRTGVSIKIMPHFDEMLLGTRTAGQ IRDVKAEDLLGRKPVTLDTSEISNRIKGKTVLVTGAGGSIGSEICRQISAFQPKEIILLG HGENSIHSIYTELNGRFGKHIVFHTEIADVQDRDKMFTLMKKYEPHVVYHAAAHKHVPLM EHNPEEAVKNNIIGTKNVAEAADMSGTETFVLISSDKAVNPANVMGATKRFAEMIIMNLG KVSRTKFVAVRFGNVLGSRGSVIPIFKKQIEKGGPVTVTHPAMTRYFMTIPEASRLVIQA GALAKGRQIFVLDMGEPVKIVDLAKNLIHLSGYTTEQVPIEFTGIRPGEKMYEELLNKNE VHAEQIFPKIHIGKAVDGDWPVLMRFIEDFHELPEADLRARLFAAINTSEEMTAASVH
Uniprot No.

Target Background

Function
Involved in biofilm formation.
Database Links
Protein Families
Polysaccharide synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of EpsC protein in Bacillus subtilis biofilm formation?

EpsC is a critical component of the exopolysaccharide (EPS) biosynthetic pathway in B. subtilis, which is essential for biofilm matrix formation. It functions as a polysaccharide biosynthesis protein and UDP-sugar epimerase involved in the synthesis of extracellular polysaccharides that form a crucial part of the biofilm architecture . The protein belongs to the GT-B fold (GT4 family) of glycosyl transferases and participates in one of the steps of the EPS biosynthetic pathway that follows the initial phosphoglycosyl transferase reactions catalyzed by EpsL and EpsD . Without functional EpsC, the architecture and functionality of the biofilm matrix would be significantly compromised, highlighting the protein's importance in community structure development.

How does EpsC relate to other proteins in the eps gene cluster?

EpsC operates within a complex exopolysaccharide (EPS) biosynthesis gene cluster in B. subtilis that includes multiple open reading frames responsible for biofilm matrix formation. The eps gene cluster consists of approximately 17 genes working in concert to produce the extracellular polysaccharide components of biofilms . Within this pathway, EpsC functions downstream of the initial biosynthetic steps performed by EpsL (which uses UDP-di-N-acetyl bacillosamine as a phospho-sugar donor for the first phosphoglycosyl transferase step) and EpsD (which utilizes the product of EpsL as an acceptor substrate and UDP-N-acetyl glucosamine as the sugar donor) . The entire cluster includes other essential components such as epsL, epsK, epsJ, epsG, and other proteins that collectively facilitate the synthesis of the complex polysaccharide structure that forms the biofilm matrix .

What methodology is used to analyze EpsC function in B. subtilis?

Analyzing EpsC function typically involves a synergistic approach combining biochemical assays, genetic studies, and comparative sequence analyses. Researchers commonly employ:

  • Gene knockout techniques: Creation of marker-free knockout strains using systems like Cre/lox or counterselectable markers (e.g., upp gene) to evaluate the phenotypic effects of EpsC deletion

  • Microscopic analysis: Scanning electron microscopy, transmission electron microscopy, and field emission scanning electron microscopy to observe changes in biofilm structure and cellular morphology resulting from EpsC mutation

  • Biochemical assays: Enzymatic activity tests to characterize the glycosyltransferase function of EpsC and its interactions with other enzymes in the pathway

  • Structural analysis of polysaccharides: Gas chromatography-mass spectrometry (GC-MS) to identify the monosaccharide components of the EPS, with peaks matched against databases like NIST-17 to determine composition changes when EpsC is modified

  • Comparative genomics: Sequence analysis against other Bacillus strains to identify conserved domains and predict protein function within the EPS biosynthetic pathway

How can I design an effective recombinant expression system for B. subtilis EpsC?

To design an effective recombinant expression system for B. subtilis EpsC, follow this methodological approach:

Selection of Expression Host:
Choose an appropriate B. subtilis strain, preferably one with reduced extracellular protease activity (e.g., WB600, WB700, or WB800) to minimize degradation of the recombinant protein . Consider using chassis strains with anti-autolysis modifications (e.g., knockout of lytC, sigD, pcfA, or flgD) to increase biomass and potentially boost protein yield .

Vector Construction:

  • Select a suitable plasmid backbone compatible with B. subtilis

  • Clone the epsC gene using fusion PCR with appropriate flanking regions

  • Choose between integrative vectors (for stable expression) or autonomously replicating plasmids depending on your research needs

Promoter Selection:
Select a promoter based on expression requirements:

  • Constitutive promoters for continuous expression

  • Inducible promoters (e.g., IPTG-inducible) for controlled expression

  • Self-inducing systems for simplified large-scale production

Secretion Strategy:
If extracellular production is needed, incorporate an appropriate signal peptide sequence to direct EpsC to the secretory pathway .

Culture Conditions Optimization:

  • Use a two-stage seed expansion culture followed by inoculation into a bioreactor

  • Implement a DO-stat fed-batch fermentation strategy for optimal production

  • For laboratory-scale production, culture at 30-37°C depending on the expression system used

Purification Approach:
Integrate a purification tag (His-tag or alternative) for simplified downstream processing, or develop a specific purification protocol based on EpsC's biochemical properties.

What are the optimal conditions for analyzing EpsC activity in vitro?

For optimal in vitro analysis of EpsC activity, researchers should consider the following methodological parameters:

Enzyme Extraction and Preparation:

  • Culture recombinant B. subtilis strains expressing EpsC in appropriate media with required antibiotics (e.g., kanamycin at 50 μg/mL)

  • Harvest cells by centrifugation (10,000 rpm for 30 min) and wash with phosphate buffer (pH 7.5)

  • Lyse cells through sonication (approximately 20 min) in the presence of lysozyme (1 g/L) to release intracellular EpsC

  • Clarify the lysate by centrifugation to obtain a crude enzyme preparation

Reaction Conditions:

  • Buffer system: Phosphate buffer (PBS, pH 7.5) provides a suitable environment for most glycosyltransferase activities

  • Temperature: 30°C is typically optimal for B. subtilis enzyme activity assays

  • Substrate preparation: As EpsC functions as a UDP-sugar epimerase in polysaccharide biosynthesis, provide appropriate UDP-sugar substrates like UDP-glucose or UDP-galactose

  • Cofactors: Include divalent cations (Mg²⁺ or Mn²⁺) which are often required for glycosyltransferase activity

Activity Detection Methods:

  • Radiolabeled substrate assays: Using ¹⁴C or ³H-labeled UDP-sugars to track transfer reactions

  • Coupled enzyme assays: Measuring released UDP or other reaction products

  • Mass spectrometry: Analyzing the glycan products formed

  • Chromatographic analysis: HPLC or GC-MS to identify and quantify reaction products

Control Reactions:

  • Include enzyme-free negative controls

  • Use heat-inactivated enzyme preparations as additional controls

  • Include positive controls using characterized glycosyltransferases with known activity

What approaches can be used to investigate EpsC interactions with other proteins in the EPS biosynthetic pathway?

To investigate EpsC interactions with other proteins in the EPS biosynthetic pathway, researchers can employ multiple complementary techniques:

Protein-Protein Interaction Analysis:

  • Bacterial two-hybrid systems: Modified specifically for use in Bacillus to detect direct protein interactions between EpsC and other EPS pathway components

  • Co-immunoprecipitation: Using antibodies against EpsC or epitope-tagged versions to pull down interaction partners

  • Pull-down assays: Using recombinant EpsC with affinity tags to capture interacting proteins from cell lysates

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry to identify proteins in close proximity to EpsC

Genetic Interaction Studies:

  • Double knockout experiments: Creating strains with deletions in both epsC and other eps genes to identify synthetic phenotypes indicating functional relationships

  • Complementation assays: Testing whether expression of other eps genes can rescue epsC deletion phenotypes

  • Suppressor screens: Identifying secondary mutations that restore function in epsC mutants

Sequential Enzyme Assays:

  • Coupled enzyme reactions using purified components of the EPS pathway to reconstruct the biosynthetic process in vitro

  • Analysis of substrate channeling by testing whether intermediates are efficiently transferred between pathway enzymes

  • Chemoenzymatic synthesis of undecaprenyl diphosphate-linked glycan substrates to study sequential steps in the pathway

Structural Biology Approaches:

  • Protein crystallization of EpsC alone or in complex with other Eps proteins

  • Cryo-electron microscopy to visualize larger complexes

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

In vivo Visualization:

  • Fluorescence microscopy using fluorescently tagged EpsC and other Eps proteins to track co-localization

  • Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) to detect direct interactions in living cells

How does the absence of EpsC affect biofilm matrix composition and structure?

The absence of EpsC significantly alters biofilm matrix composition and structure in B. subtilis through several measurable mechanisms:

Matrix Composition Changes:
When EpsC is deleted or non-functional, the exopolysaccharide component of the biofilm matrix undergoes substantial alterations. GC-MS analysis of biofilm matrix from eps mutant strains reveals significant changes in monosaccharide composition, typically showing reduced levels of glucose (normally detected at R.T. 22.50 with a normalized area of 1.23), galactose (R.T. 20.928, normalized area 3.27), and sedoheptulose (R.T. 22.73, normalized area -5.54) . These monosaccharides are key components of the extracellular heteropolysaccharides that form the biofilm scaffold.

Structural Alterations:

  • Pellicle formation: While wild-type strains form complete encircling pellicles with cell agglomeration, eps mutants (including those lacking functional EpsC) form incomplete pellicles with significantly reduced structural integrity

  • Bacterial flocculation: EpsC-deficient strains show markedly decreased flocculation compared to wild-type strains

  • Biofilm architecture: The three-dimensional structure of the biofilm becomes less robust, with reduced height and altered surface topology

Functional Consequences:

  • Reduced hydrophobicity: The biofilm surface becomes less water-repellent due to changes in EPS composition

  • Altered cell-cell adhesion: Decreased intercellular connections lead to more fragile biofilm communities

  • Increased susceptibility to environmental stresses: The compromised matrix provides less protection against antimicrobials, pH fluctuations, and mechanical disruption

Compensatory Mechanisms:
In response to EpsC deficiency, B. subtilis may increase production of other biofilm matrix components such as TasA amyloid fibers or the hydrophobin-like protein BslA to partially compensate for EPS deficiency, though these substitutions cannot fully restore normal biofilm architecture.

What is the relationship between EpsC function and the regulation of biofilm formation in response to environmental signals?

The relationship between EpsC function and biofilm formation regulation in response to environmental signals involves complex signaling networks:

Regulatory Pathway Integration:
EpsC function is integrated into multiple regulatory circuits that respond to environmental cues. The expression of epsC and the entire eps operon is primarily controlled by the master regulator Spo0A, which is activated through a phosphorelay system that senses diverse environmental inputs . In response to nutrient limitation, population density, and other stressors, phosphorylated Spo0A alleviates SinR repression of the eps operon, leading to increased EpsC production and subsequent enhancement of EPS biosynthesis.

Signal-Response Mechanisms:

  • Nutrient availability: Under nutrient-limited conditions, increased Spo0A phosphorylation leads to enhanced epsC expression and EPS production

  • Quorum sensing: Cell density signals modulate epsC expression through the ComQXPA system

  • Osmotic stress: Changes in osmolarity affect EpsC activity and subsequent polysaccharide production

  • Redox conditions: Oxidative stress influences EPS composition through effects on EpsC function

Temporal Regulation:
EpsC activity follows a specific temporal pattern during biofilm development:

  • Initial attachment phase: Low EpsC activity with minimal EPS production

  • Maturation phase: Upregulation of EpsC contributes to increased EPS synthesis

  • Dispersal phase: Downregulation or modification of EpsC activity

Spatial Expression Patterns:
Within biofilms, epsC expression and activity shows heterogeneity:

  • Peripheral regions: Higher EpsC activity correlates with active EPS production

  • Central/basal regions: Different EpsC activity patterns support biofilm architecture

  • Cell subpopulations: Differentiated expression creates functional heterogeneity within the community

Cross-talk with Other Biosynthetic Pathways:
EpsC function influences and is influenced by other cellular processes:

  • Energy metabolism: ATP availability affects EpsC-mediated EPS production

  • Cell division: Changes in growth rate modulate EpsC expression

  • Sporulation: The decision between biofilm formation and sporulation affects EpsC activity through shared regulatory components like Spo0A

What strategies can be employed to engineer EpsC for enhanced EPS production or modified biofilm properties?

Engineering EpsC for enhanced EPS production or modified biofilm properties can be approached through several advanced strategies:

Protein Engineering Approaches:

  • Site-directed mutagenesis: Targeting catalytic residues to enhance enzymatic efficiency or alter substrate specificity

  • Domain swapping: Exchanging functional domains with homologous proteins from other bacterial species to create hybrid enzymes with novel properties

  • Directed evolution: Generating libraries of epsC variants and selecting for those with desired characteristics

  • Rational design: Using structural modeling to predict mutations that might enhance activity or stability

Expression Optimization:

  • Promoter engineering: Replacing the native promoter with stronger, constitutive, or tunable promoters

  • RBS optimization: Modifying the ribosome binding site to enhance translation efficiency

  • Codon optimization: Adjusting codon usage to match B. subtilis preferences for increased expression

  • Transcriptional terminator engineering: Reducing premature transcription termination

Metabolic Engineering Strategies:

  • Precursor supply enhancement: Increasing the availability of UDP-sugars and other substrates required for EpsC activity

  • Competing pathway downregulation: Reducing flux through pathways that compete for EpsC substrates

  • Cofactor availability optimization: Ensuring sufficient levels of required cofactors

Synthetic Biology Approaches:

  • Orthogonal expression systems: Creating synthetic regulatory circuits to control epsC expression independently of native regulation

  • Biosensor-based control: Linking epsC expression to specific environmental signals through engineered biosensors

  • Minimal genetic context: Removing unnecessary genes from the eps operon to focus resources on essential functions

Why might recombinant EpsC show reduced activity compared to native expression?

Recombinant EpsC may show reduced activity compared to natively expressed protein due to several factors that researchers should systematically investigate:

Protein Folding and Processing Issues:

  • Incorrect folding: Overexpression may overwhelm the host's chaperone systems, leading to misfolded protein

  • Post-translational modifications: Native modifications may be missing in recombinant systems

  • Protein aggregation: High-level expression can lead to inclusion body formation with reduced soluble protein

Expression System Limitations:

  • Codon usage bias: Non-optimized codons can reduce translation efficiency and affect protein folding

  • Promoter strength: Excessively strong promoters may cause metabolic burden

  • Plasmid stability: Loss of expression vectors during cultivation

  • Copy number effects: High copy number plasmids may disrupt cellular homeostasis

Host Strain Considerations:

Experimental Context:

  • Assay conditions: Suboptimal pH, temperature, or buffer composition

  • Substrate availability: Insufficient UDP-sugar substrates or related cofactors

  • Lack of interacting partners: EpsC may require other Eps proteins for full activity

  • Regulatory factors: Missing regulatory factors that enhance native EpsC activity

Methodological approach to troubleshooting:

  • Perform Western blot analysis to confirm protein expression and size

  • Test different induction conditions (temperature, inducer concentration)

  • Compare soluble vs. insoluble fractions to assess aggregation

  • Consider alternative host strains with reduced protease activity

  • Optimize cultivation parameters (media composition, aeration, pH)

How can I distinguish between biofilm defects caused by EpsC dysfunction versus other EPS biosynthetic proteins?

Distinguishing between biofilm defects caused by EpsC dysfunction versus other EPS biosynthetic proteins requires a comprehensive experimental approach:

Genetic Complementation Analysis:

  • Create single gene knockout strains of epsC and other eps genes individually

  • Perform phenotypic characterization of each mutant strain

  • Introduce wild-type copies of each gene on expression vectors to complement the respective mutations

  • Compare restoration of biofilm phenotype among different complemented strains

  • Conduct cross-complementation tests to determine if overexpression of one Eps protein can compensate for the loss of another

Biochemical Characterization:

  • Analyze EPS composition using GC-MS to identify specific changes in monosaccharide content associated with each mutant

  • Compare chromatographic profiles (normalized areas at specific retention times) for glucose, galactose, and sedoheptulose in different mutants

  • Perform sequential enzymatic assays with purified components to identify which step in the pathway is compromised

  • Use mass spectrometry to analyze the structure of intermediate products accumulated in different mutants

Structural Analysis:

  • Compare biofilm morphology using scanning electron microscopy and transmission electron microscopy

  • Quantify differences in pellicle formation, cell aggregation, and flocculation between different mutants

  • Measure biofilm properties such as hydrophobicity, mechanical strength, and matrix density

  • Assess spatial distribution of cells and matrix components using fluorescent stains and confocal microscopy

Molecular Interaction Studies:

  • Investigate protein-protein interactions between EpsC and other Eps proteins

  • Determine if EpsC localization is affected in mutants of other eps genes

  • Assess substrate utilization in different mutants using radiolabeled precursors

Phenotypic Response Profiling:

  • Compare responses to environmental stresses (antibiotics, osmotic stress, pH fluctuations)

  • Evaluate biofilm dispersal kinetics in different mutants

  • Assess colony morphology on different media compositions

  • Analyze motility patterns on semi-solid media

What are the potential pitfalls in interpreting EpsC function based on knockout strain phenotypes?

Interpreting EpsC function based on knockout strain phenotypes presents several potential pitfalls that researchers must carefully consider:

Polar Effects on Gene Expression:

  • Deletion of epsC may affect expression of downstream genes in the eps operon

  • The knockout methodology used (marker insertion, clean deletion) can have different impacts on neighboring gene expression

  • Transcriptional readthrough from marker genes may influence expression patterns

Compensatory Mechanisms:

  • The absence of EpsC may trigger upregulation of alternative pathways

  • Other glycosyltransferases might partially compensate for EpsC function

  • Adaptive mutations may arise during cultivation of knockout strains

  • Increased expression of other biofilm matrix components (e.g., protein components) may mask EPS deficiencies

Strain Background Effects:

  • Different laboratory strains of B. subtilis show variation in biofilm formation capabilities

  • The genetic background may contain suppressor mutations that influence phenotype

  • Growth conditions and media composition can significantly impact the manifestation of knockout phenotypes

  • Historical strain manipulations may have introduced unintended mutations

Pleiotropic Effects:

  • EpsC may have multiple functions beyond its predicted glycosyltransferase activity

  • Knockout effects may manifest through altered cell morphology or growth patterns

  • Changes in EPS composition may have secondary effects on other cellular processes

Technical Limitations:

  • Biofilm quantification methods vary in sensitivity and specificity

  • Batch-to-batch variation in biofilm assays can confound interpretations

  • Laboratory conditions may not reflect the natural environmental context

  • Standard laboratory media may not induce optimal biofilm formation

Methodological approach to mitigate misinterpretation:

  • Use multiple knockout strategies (marker replacement, markerless deletion) to confirm phenotypes

  • Complement knockouts with controlled expression of epsC to verify direct causality

  • Create point mutations in catalytic domains rather than complete gene deletions

  • Perform time-course studies to distinguish primary from secondary effects

  • Test phenotypes under diverse environmental conditions

  • Use multi-omics approaches (transcriptomics, proteomics, metabolomics) to comprehensively characterize knockout strains

How might structural analysis of EpsC inform the design of biofilm inhibitors targeting exopolysaccharide synthesis?

Structural analysis of EpsC could significantly inform the design of biofilm inhibitors through several strategic approaches:

Structure-Based Drug Design:
Determining the three-dimensional structure of EpsC through X-ray crystallography or cryo-electron microscopy would reveal critical features for inhibitor design:

  • Active site architecture: Identifying the catalytic pocket would allow for the design of competitive inhibitors that mimic natural substrates

  • Allosteric sites: Discovering regulatory binding pockets could lead to allosteric inhibitors that alter protein conformation

  • Protein-protein interaction interfaces: Mapping the surfaces where EpsC interacts with other EPS biosynthetic proteins could inform the development of interaction disruptors

Catalytic Mechanism Insights:
Understanding the reaction mechanism of EpsC would reveal:

  • Transition state structures: Enabling the design of transition state analogs with high binding affinity

  • Required cofactors: Identifying opportunities to develop cofactor competitors

  • Rate-limiting steps: Revealing optimal points for intervention in the catalytic cycle

Comparative Structural Analysis:
Comparing EpsC structure with homologs from other species would:

  • Highlight conserved regions essential for function across species

  • Identify unique structural features specific to B. subtilis that could be selectively targeted

  • Reveal natural variations that could guide inhibitor optimization

Molecular Dynamics Simulations:
Computational analysis of EpsC dynamics would provide:

  • Insights into protein flexibility and conformational changes during catalysis

  • Identification of transient pockets that appear during protein motion

  • Prediction of binding energies for potential inhibitors

Fragment-Based Drug Discovery:
Using structural information to guide fragment screening would enable:

  • Identification of small molecular fragments that bind to different regions of EpsC

  • Linking of fragments to create high-affinity inhibitors

  • Growth of fragments into larger inhibitors with improved pharmacological properties

Table 2: Potential EpsC Inhibition Strategies Based on Structural Analysis

Inhibition StrategyStructural TargetExpected EffectPotential ApplicationsTechnical Approach
Active site blockadeSubstrate binding pocketDirect inhibition of catalytic activityBiofilm preventionStructure-based virtual screening
Allosteric modulationRegulatory domainsConformational changes preventing catalysisBiofilm dispersalNMR-based fragment screening
Interface disruptionProtein-protein interaction surfacesPrevention of complex formationCombined therapy with other agentsPeptide mimetics design
Covalent inhibitionCatalytic residuesIrreversible enzyme inactivationLong-lasting anti-biofilm effectTargeted reactive group design
Substrate competitionUDP-sugar binding siteCompetitive inhibitionResearch toolsSubstrate analog synthesis

What are the evolutionary implications of the conserved nature of EpsC across Bacillus species?

The conserved nature of EpsC across Bacillus species has significant evolutionary implications that inform our understanding of biofilm evolution and bacterial adaptation:

Phylogenetic Conservation Patterns:
EpsC shows remarkable conservation across the Bacillus genus, suggesting:

  • Ancient evolutionary origin predating species divergence

  • Strong selective pressure to maintain function

  • Essential role in bacterial fitness and survival

  • Conservation of core catalytic machinery while allowing species-specific variations in regulatory domains

Functional Constraints:
The conservation of EpsC reflects critical functional constraints:

  • Specific substrate recognition requirements

  • Precise interactions with partner proteins in the EPS biosynthetic machinery

  • Optimal catalytic efficiency under diverse environmental conditions

  • Integration into conserved regulatory networks controlling biofilm formation

Horizontal Gene Transfer Dynamics:
Analysis of EpsC and the eps operon suggests:

  • Limited horizontal transfer of the complete EPS biosynthetic pathway

  • Modular evolution where certain domains may be exchanged between species

  • Co-evolution with other components of the biofilm matrix

  • Potential differences in transfer rates between regulatory elements and catalytic components

Adaptive Diversification:
Despite core conservation, species-specific variations in EpsC reveal:

  • Adaptations to different ecological niches

  • Fine-tuning of EPS composition for specific environmental challenges

  • Co-evolution with host immune systems (for pathogenic or commensal species)

  • Differential regulation in response to species-specific environmental cues

Implications for Synthetic Biology:
Understanding the evolutionary constraints on EpsC informs:

  • Design principles for engineering novel EPS biosynthetic pathways

  • Prediction of functional compatibility when transferring genes between species

  • Identification of evolutionarily robust domains suitable for protein engineering

  • Recognition of natural solutions to biochemical challenges that can inspire biomimetic approaches

How can systems biology approaches integrate EpsC function into broader biofilm regulatory networks?

Systems biology approaches can effectively integrate EpsC function into broader biofilm regulatory networks through several sophisticated methodological strategies:

Multi-Omics Data Integration:

  • Transcriptomics: RNA-seq analysis comparing wild-type and epsC mutant strains under biofilm-inducing conditions to identify genes with altered expression

  • Proteomics: Quantitative proteomics to detect changes in protein abundance and post-translational modifications

  • Metabolomics: Profiling of metabolite changes to identify alterations in precursor availability and product formation

  • Interactomics: Systematic mapping of protein-protein interactions involving EpsC

  • Integration platform: Development of computational frameworks to synthesize multi-omics datasets into coherent network models

Network Reconstruction and Analysis:

  • Bayesian network inference: Using conditional dependencies to infer regulatory relationships

  • Boolean network modeling: Simplifying complex interactions into logical (ON/OFF) relationships

  • Differential equation-based models: Capturing detailed dynamics of EpsC regulation

  • Genome-scale metabolic models: Integrating EpsC function into whole-cell metabolic networks

  • Network topology analysis: Identifying hubs, bottlenecks, and motifs in the regulatory network

Perturbation Studies:

  • Systematic gene knockouts: Creating a matrix of single and double mutants to identify genetic interactions

  • Environmental perturbations: Examining network responses to diverse stressors

  • Dose-response analysis: Titrating inducer or inhibitor concentrations to probe network sensitivity

  • Temporal perturbations: Analyzing time-dependent responses to sudden environmental changes

  • Spatial perturbations: Examining localized responses within biofilm structures

Regulatory Circuit Mapping:

  • Identification of transcription factors directly controlling epsC expression

  • Mapping of signaling pathways that modulate EpsC activity

  • Characterization of feedback loops involving EPS production and sensing

  • Integration with global regulators like Spo0A, DegU, and ComA

  • Cross-talk analysis between biofilm formation and other cellular processes (sporulation, competence, motility)

Predictive Modeling:

  • Development of machine learning algorithms to predict biofilm formation based on genetic and environmental inputs

  • In silico testing of intervention strategies targeting EpsC or related components

  • Sensitivity analysis to identify the most influential parameters in the network

  • Multi-scale modeling connecting molecular interactions to community-level phenomena

  • Validation of model predictions through targeted experimental verification

Table 3: Systems Biology Approaches for Studying EpsC in Biofilm Networks

ApproachMethodologyKey Insights ProvidedTechnological RequirementsIntegration Challenges
Transcriptional network mappingRNA-seq with network inferenceRegulatory inputs controlling epsC expressionHigh-throughput sequencing, computational resourcesDistinguishing direct from indirect effects
Protein interaction networkAffinity purification-mass spectrometryPhysical interaction partners of EpsCProtein tagging, sensitive MS detectionMaintaining native interaction conditions
Metabolic flux analysis¹³C labeling with metabolic modelingSubstrate utilization and product formationIsotope labeling, analytical chemistryCompartmentalization of metabolic processes
Dynamic response profilingTime-series analysis with perturbationsTemporal coordination of EpsC activityAutomated sampling, real-time monitoringSynchronization of cellular populations
Multi-scale spatial modelingAgent-based modeling with experimental validationEmergent properties at biofilm community levelConfocal microscopy, computational simulationConnecting molecular mechanisms to macroscale phenomena

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.