Recombinant Bacillus subtilis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Mechanism

Lgt facilitates the first step in bacterial lipoprotein biosynthesis:

ProcessDescriptionKey MoleculesSource
Lipid ModificationTransfers a diacylglyceryl group from phosphatidylglycerol to prelipoproteinsPhosphatidylglycerol → Diacylglyceryl-Lgt
Signal Peptide CleavageSubsequent processing by signal peptidase II (Lsp) removes the leader sequenceLsp → Mature lipoprotein
Membrane LocalizationLipid anchor ensures integration into the outer leaflet of the cytoplasmic membraneDiacylglyceryl-cysteine bond

In B. subtilis, Lgt is non-essential for viability, unlike in Gram-negative bacteria, where its deletion is lethal . The enzyme’s activity is critical for lipoprotein functionality, as unmodified prelipoproteins are released into the extracellular medium .

Key Functions

  • Membrane Protein Anchoring: Lgt-modified lipoproteins include transporters, receptors, and virulence factors .

  • Signal Peptide Processing: Lgt activity is prerequisite for Lsp-mediated cleavage of the leader peptide .

  • Spore Germination: Lipoproteins modified by Lgt (e.g., GerA/B receptors) regulate nutrient-triggered spore germination in B. subtilis .

Impact of Lgt Deletion

PhenotypeObservationSource
Lipoprotein SecretionIncreased extracellular release of unmodified prelipoproteins
Spore GerminationDelayed germination in nutrient-responsive receptors (GerA/B)
Protein SecretionReduced efficiency due to impaired foldase activity (e.g., PrsA)
Cytochrome FunctionDiminished cytochrome caa₃ oxidase activity due to mislocalized subunit II

Advantages of B. subtilis as a Host

FeatureApplicationSource
GRAS StatusSafe for industrial protein production
Secretion SystemsHigh-yield secretion of recombinant proteins (e.g., nanobodies, enzymes)
Lgt-Dependent SelectionPlasmid stabilization via lgt deletion/complementation (antibiotic-free)

Lgt-Engineered Systems

  • Plasmid Stability: Deletion of lgt in B. subtilis allows plasmid maintenance via lgt complementation, eliminating antibiotic dependency .

  • Protein Yield: Proper lipoprotein processing ensures functional secretion of recombinant proteins (e.g., cholera toxin B subunit) .

Table 1: Comparative Analysis of Lgt Mutants in B. subtilis

StrainLipoprotein ModificationProtein SecretionSpore GerminationCytochrome Activity
Wild-TypeDiacylatedNormalNormal100%
ΔlgtUnmodifiedReducedDelayed (GerA/B)~50% (CtaC signal peptide retained)

Data compiled from .

Key Discoveries

  1. Lgt-Independent Processing: Some lipoproteins (e.g., QoxA in Listeria) retain membrane localization without Lgt activity, suggesting alternative anchoring mechanisms .

  2. Germination Defects: Cysteine-to-alanine mutations in GerA receptors (Cys18Ala) mimic lgt deletion, confirming Lgt’s role in receptor lipidation .

  3. Protease Sensitivity: B. subtilis Δlgt strains exhibit increased cell lysis, correlating with elevated cytoplasmic protein release .

Challenges and Future Directions

  • Lgt-Dependent Expression: Optimization of lgt-complemented systems for high-throughput protein production .

  • Structural Insights: Elucidating Lgt’s membrane topology and conserved motifs (e.g., the Lgt signature motif) for targeted engineering .

  • Pathogenic Applications: Leveraging Lgt’s role in virulence (e.g., B. anthracis spore germination) for antimicrobial development .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare accordingly.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are defaulted with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
lgt; gerF; BSU34990; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase; Spore germination protein GerF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
lgt
Target Protein Sequence
MNEAIEPLNPIAFQLGPLAVHWYGIIIGLGALLGLWIAMRESEKRGLQKDTFIDLVLFAI PIAIICARIYYVAFEWDYYAAHPGEIIKIWKGGIAIHGGLIGAILTGYVFSRVKNLSFWK LADIAAPSILLGQAIGRWGNFMNQEAHGEAVSRAFLENLHLPEFIINQMYINGQYYHPTF LYESLWSFVGVIVLLLLRRANLRRGEMFLIYIIWYSIGRYFIEGMRTDSLMLTDSLRIAQ VISIVLIVLAVAAIIFRRVKGYSKERYAE
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) is an enzyme that catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins. Lgt is essential for spore germination in Bacillus subtilis.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Lgt in Bacillus subtilis?

Lgt (prolipoprotein diacylglyceryl transferase) in B. subtilis catalyzes the first reaction in the lipomodification of bacterial lipoproteins. This enzyme transfers diacylglycerol to a cysteine residue near the N-terminus of prelipoproteins, which is a critical step in bacterial lipoprotein biogenesis. The process is essential for proper anchoring of lipoproteins to bacterial membranes, which in turn affects various cellular functions including maintenance of cell envelope architecture, nutrient uptake, and secretion processes .

To study this function experimentally, researchers typically use genetic approaches such as gene inactivation through nonsense mutations or gene disruption. The effects can then be analyzed by monitoring the lipomodification status of known lipoproteins (like PrsA and BlaP) using protein analysis techniques such as gel electrophoresis coupled with western blotting or mass spectrometry to detect changes in protein mobility or modifications.

How does Lgt inactivation in B. subtilis differ from its effects in Gram-negative bacteria?

Unlike in Gram-negative bacteria where Lgt deletion is typically lethal, B. subtilis can survive without functional Lgt. Experimental evidence shows that Lgt mutants of B. subtilis remain fully viable despite complete abolishment of prelipoprotein modification . This represents a fundamental difference in lipoprotein processing requirements between bacterial types.

When studying this phenomenon, researchers should employ comparative genomics and proteomics to identify compensatory mechanisms that might exist in B. subtilis. Cross-species complementation experiments, where the Lgt from Gram-negative bacteria is expressed in B. subtilis Lgt mutants (and vice versa), can provide insights into the functional differences of the enzyme between bacterial types.

What happens to prelipoproteins in Lgt-deficient B. subtilis strains?

To investigate this process, researchers should employ cell fractionation techniques to separate membrane, cytoplasmic, and extracellular fractions, followed by immunodetection of specific lipoproteins in each fraction. Pulse-chase experiments with radioactively labeled amino acids can also track the fate of newly synthesized prelipoproteins over time.

What are the recommended methods for creating and confirming Lgt mutants in B. subtilis?

Creating reliable Lgt mutants requires careful genetic manipulation and thorough verification. Based on established protocols, researchers should consider the following methodological approach:

  • Gene inactivation through either:

    • Introduction of a nonsense mutation (similar to the prs-11 mutation)

    • Complete gene disruption using homologous recombination

  • Verification steps include:

    • PCR confirmation of the mutation or disruption

    • Sequencing of the lgt gene region

    • Functional assays to confirm the loss of diacylglycerol transferase activity

  • Complementation tests:

    • Reintroduction of the wild-type lgt gene to restore function

    • Expression of the gene under an inducible promoter to allow controlled studies

For confirmation of mutations, researchers should use restrictive PCR conditions to verify the presence of expected mutations, as demonstrated in the approach used for gerF (lgt) mutants . Additionally, sequencing of the mutated region is essential to confirm the precise genetic changes.

How can researchers quantitatively assess the effects of Lgt mutation on protein secretion?

Protein secretion impairment is a prominent phenotype of Lgt mutants in B. subtilis. To quantitatively assess this effect, researchers should employ the following methodological approach:

  • Establish reporter protein systems:

    • Select well-characterized secreted proteins (e.g., amylases, proteases)

    • Create fusion constructs with easily detectable tags or reporter enzymes

  • Quantification methods:

    • Enzyme activity assays in culture supernatants

    • Western blot analysis with densitometry

    • Mass spectrometry-based proteomics of secreted proteins

  • Data analysis:

    • Calculate secretion efficiency by comparing intracellular vs. extracellular protein levels

    • Establish time-course experiments to determine secretion kinetics

    • Compare results to wild-type strains under identical conditions

When interpreting results, it's important to consider that the reduced levels of the PrsA lipoprotein (a foldase involved in protein secretion) in Lgt mutants directly contributes to the impaired protein secretion phenotype . Therefore, complementation experiments with overexpressed PrsA can help distinguish direct from indirect effects of Lgt mutation.

What techniques are effective for analyzing lipoprotein localization in B. subtilis Lgt mutants?

To properly analyze lipoprotein localization in Lgt mutants, researchers should employ multiple complementary techniques:

  • Cell fractionation:

    • Separate membrane, cytoplasmic, and extracellular fractions using differential centrifugation

    • Use marker proteins to validate the purity of each fraction

  • Fluorescence microscopy:

    • Create GFP fusions with lipoproteins of interest

    • Visualize localization patterns in live cells

    • Compare wild-type vs. Lgt mutant strains

  • Immunoelectron microscopy:

    • Prepare ultrathin sections of bacterial cells

    • Use gold-labeled antibodies against specific lipoproteins

    • Quantify gold particle distribution across cellular compartments

  • Membrane protein extraction:

    • Use different detergents to extract proteins based on membrane association strength

    • Analyze extraction patterns to determine the nature of protein-membrane interactions

These techniques have revealed that non-lipomodified precursors in Lgt mutants can still associate with membranes, possibly through their signal peptides that are not efficiently processed in the absence of lipid modification .

How does Lgt mutation affect spore germination in B. subtilis, and what experimental approaches best characterize this phenotype?

Lgt mutation (also referred to as gerF mutation) significantly impacts spore germination in B. subtilis, with effects varying depending on the specific nutrient receptor involved. To properly characterize this phenotype, researchers should implement the following methodological approaches:

  • Quantitative germination assays:

    • Monitor optical density decrease (OD600) during germination

    • Track dipicolinic acid (DPA) release

    • Perform phase-contrast microscopy to count phase-dark (germinated) vs. phase-bright (dormant) spores

  • Receptor-specific analysis:

    • Use defined germinants that activate specific receptors (GerA, GerB, or GerK)

    • Create combination mutants lacking specific receptors

    • Compare germination kinetics across different receptor pathways

  • Colony formation efficiency:

    • Plate heat-activated spores on nutrient media

    • Count colony-forming units (CFU) after defined incubation periods

    • Calculate germination efficiency relative to wild-type spores

Based on experimental data, Lgt mutation has differential effects on germination receptors: GerA receptor function is heavily impaired, GerB receptor function is moderately affected, while GerK receptor function shows minimal disruption . This pattern correlates with the effects observed when the cysteine residue that normally receives diacylglycerol is mutated to alanine in each receptor.

The table below summarizes the differential impacts of Lgt mutation on different germination pathways:

Germination PathwayImpact in Lgt MutantsRelative Germination EfficiencyAlternative Triggers
GerA-mediatedSeverely reduced<10% of wild-typeNot bypassed
GerB-mediatedModerately reduced30-50% of wild-typePartially bypassed
GerK-mediatedMinimally affected80-90% of wild-typeFully functional
Ca²⁺-DPA triggeredNormal100% of wild-typeIndependent of Lgt
DodecylamineNormal100% of wild-typeIndependent of Lgt

What is the relationship between lipid modification and signal peptide processing in B. subtilis, and how can this be investigated?

In B. subtilis, lipid modification appears to be a prerequisite for efficient signal peptide cleavage, creating an interesting research question about the coordination between these two processes. To investigate this relationship, researchers should consider the following approach:

  • Pulse-chase experiments:

    • Radioactively label proteins in vivo

    • Chase with non-labeled amino acids

    • Analyze the processing kinetics of specific prelipoproteins

  • In vitro reconstitution:

    • Purify signal peptidase II (Lsp) and substrate prelipoproteins

    • Test cleavage efficiency with lipid-modified vs. non-modified substrates

    • Analyze the structural requirements for recognition

  • Site-directed mutagenesis:

    • Create mutations in the lipobox sequence

    • Analyze effects on both lipid modification and signal peptide cleavage

    • Establish structure-function relationships

  • Cryo-electron microscopy:

    • Visualize the spatial arrangement of the lipoprotein processing machinery

    • Determine if physical interactions exist between Lgt and signal peptidases

Experimental evidence indicates that inactivation of Lgt abolishes not only lipomodification of prelipoproteins but also the cleavage of their signal peptides . This suggests that the lipoprotein processing pathway in B. subtilis operates sequentially, with diacylglycerol transfer being a prerequisite for signal peptide removal.

How can researchers differentiate between direct and indirect effects of Lgt mutation on cellular processes?

Distinguishing direct from indirect effects of Lgt mutation presents a significant challenge in understanding the precise role of this enzyme. Researchers should implement a multi-faceted approach:

  • Complementation strategies:

    • Reintroduce wild-type Lgt under inducible promoters

    • Create a titration series with varying expression levels

    • Determine which phenotypes are restored at what expression threshold

  • Individual lipoprotein complementation:

    • Overexpress specific lipoproteins (e.g., PrsA) in the Lgt mutant background

    • Determine which phenotypes are rescued by individual lipoproteins

    • Identify lipoproteins that are critical for specific cellular functions

  • Alternative anchoring strategies:

    • Modify lipoproteins with alternative membrane anchors (transmembrane domains)

    • Test if function is restored when membrane localization is achieved by other means

    • Determine if specific lipid modification is required beyond membrane anchoring

  • Temporal analysis:

    • Use time-course experiments to track the development of different phenotypes

    • Establish cause-and-effect relationships between primary and secondary effects

    • Implement metabolic and proteomic profiling at multiple time points

For example, research has shown that the reduced level of the PrsA lipoprotein in Lgt mutants directly causes impaired protein secretion . By experimentally increasing PrsA levels through overexpression, researchers can determine whether this rescues the secretion defect, thereby confirming the indirect nature of this particular Lgt mutation consequence.

What critical residues and domains are essential for B. subtilis Lgt function, and how can they be experimentally identified?

Understanding the structure-function relationships of B. subtilis Lgt requires identification of critical residues and domains. Based on comparative studies with E. coli Lgt, researchers should consider the following methodological approaches:

  • Site-directed mutagenesis:

    • Target conserved residues identified through sequence alignment with E. coli Lgt

    • Focus on residues like Arg143 and Arg239, which are essential for diacylglyceryl transfer in E. coli

    • Create alanine-scanning libraries to systematically identify functional residues

  • Domain swap experiments:

    • Exchange domains between B. subtilis and E. coli Lgt

    • Test chimeric proteins for function in both organisms

    • Identify domains responsible for substrate specificity or catalytic activity

  • Structural analysis:

    • Generate homology models based on the E. coli Lgt crystal structure

    • Identify putative substrate binding sites and catalytic residues

    • Verify predictions through targeted mutagenesis

  • Enzymatic assays:

    • Develop in vitro assays using purified Lgt and synthetic substrates

    • Measure kinetic parameters (Km, Vmax) for wild-type and mutant enzymes

    • Correlate structural features with enzyme activity

While the crystal structure of B. subtilis Lgt has not been reported, insights from the E. coli Lgt structure suggest the presence of two binding sites and provide a foundation for understanding the mechanism of diacylglyceryl transfer . Researchers should exploit this knowledge while acknowledging potential species-specific differences.

How do lipid composition and membrane properties affect Lgt activity in B. subtilis?

The membrane environment likely plays a critical role in regulating Lgt activity. To investigate this relationship, researchers should employ the following experimental approaches:

  • Membrane lipid manipulation:

    • Use genetic approaches to alter phospholipid composition

    • Apply chemical treatments to modify membrane fluidity

    • Analyze effects on Lgt activity and lipoprotein processing

  • Reconstitution in artificial membranes:

    • Purify Lgt and reconstitute in liposomes of defined composition

    • Vary lipid species, chain length, saturation, and head group

    • Measure enzyme activity as a function of membrane properties

  • Biophysical characterization:

    • Use fluorescence anisotropy to measure membrane fluidity

    • Apply differential scanning calorimetry to detect phase transitions

    • Correlate membrane physical properties with enzyme function

  • Molecular dynamics simulations:

    • Model Lgt behavior in membranes of different composition

    • Predict how membrane properties affect substrate access and product release

    • Generate testable hypotheses about Lgt-membrane interactions

These approaches can help determine if the lateral entry and exit mechanism proposed for E. coli Lgt is conserved in B. subtilis, and how membrane properties might influence this process. Such knowledge is particularly relevant given that B. subtilis can survive without Lgt, suggesting potential compensatory mechanisms that might be influenced by membrane composition.

How can the unique properties of B. subtilis Lgt be utilized for protein engineering and heterologous expression systems?

The unique properties of the B. subtilis Lgt system, particularly the ability of B. subtilis to survive without functional Lgt, offer interesting opportunities for protein engineering. Researchers can explore these possibilities through:

  • Development of novel anchoring systems:

    • Engineer artificial lipoproteins with optimized lipoboxes

    • Create expression vectors for surface display of recombinant proteins

    • Optimize signal sequences for efficient processing and membrane localization

  • Controlled release strategies:

    • Exploit the property that non-lipomodified proteins are released from cells

    • Create inducible Lgt systems to control protein retention vs. release

    • Develop two-phase fermentation processes with controlled product secretion

  • Lipoprotein-based vaccine development:

    • Use B. subtilis as a platform for displaying immunogenic epitopes

    • Engineer lipid-modified antigens with enhanced immunogenicity

    • Develop whole-cell vaccine candidates with surface-displayed antigens

  • Membrane protein production:

    • Express difficult membrane proteins as lipoprotein fusions

    • Utilize the natural membrane association of lipoproteins

    • Develop extraction and purification strategies specific for lipoproteins

These applications should build upon the understanding that non-lipomodified precursors of proteins like PrsA remain functional despite lacking lipid modification , offering flexibility in protein design and expression strategies.

What advanced imaging techniques can be applied to study the spatial organization of Lgt and its substrates in B. subtilis?

Understanding the spatial organization of Lgt and its substrates requires sophisticated imaging approaches:

  • Super-resolution microscopy:

    • Apply techniques like PALM, STORM, or STED microscopy

    • Visualize Lgt distribution with nanometer precision

    • Track the dynamics of enzyme localization during different growth phases

  • Single-molecule tracking:

    • Label Lgt and substrate proteins with photoactivatable fluorophores

    • Track individual molecules to determine diffusion rates and interaction dynamics

    • Identify potential microdomains or processing centers

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence imaging with electron microscopy

    • Correlate protein localization with ultrastructural features

    • Achieve both molecular specificity and high structural resolution

  • Expansion microscopy:

    • Physically expand the bacterial cell to improve resolution

    • Visualize spatial relationships between Lgt, substrates, and other processing enzymes

    • Detect subtle changes in localization patterns in response to physiological changes

  • FRET-based interaction studies:

    • Create donor-acceptor pairs with Lgt and substrate proteins

    • Measure interaction dynamics in living cells

    • Determine the spatial and temporal coordination of lipoprotein processing

These techniques can reveal whether Lgt is uniformly distributed throughout the membrane or concentrated in specific regions, which could have important implications for understanding lipoprotein processing efficiency and regulation.

What are the most promising research directions for studying B. subtilis Lgt that remain unexplored?

Several promising research directions deserve attention:

  • Systems biology approaches:

    • Comprehensive proteomic analysis of the lipoproteome in wild-type vs. Lgt mutants

    • Network analysis to identify compensatory pathways in Lgt-deficient cells

    • Multi-omics integration to understand the global impact of Lgt mutation

  • Evolutionary perspectives:

    • Comparative analysis of Lgt function across diverse Gram-positive species

    • Investigation of how bacteria evolved different dependencies on Lgt

    • Identification of potential alternative lipomodification pathways

  • Structural biology:

    • Determination of the B. subtilis Lgt crystal structure

    • Comparative analysis with E. coli Lgt to identify species-specific features

    • Structure-guided design of specific inhibitors or activity modulators

  • Physiology and stress adaptation:

    • Role of Lgt in different growth phases and stress conditions

    • Investigation of how Lgt activity is regulated in response to environmental changes

    • Connection between lipoprotein processing and stress resistance

These directions should build upon the established knowledge that B. subtilis can survive without functional Lgt , which represents a fundamental difference from Gram-negative bacteria and suggests the presence of alternative mechanisms that could provide new insights into bacterial physiology and potential antimicrobial targets.

How can contradictory data regarding Lgt function in B. subtilis be reconciled through improved experimental design?

To address contradictions in the literature, researchers should implement robust experimental designs:

  • Standardization of genetic backgrounds:

    • Use defined laboratory strains with complete genome sequencing

    • Create isogenic strains differing only in the Lgt gene

    • Monitor for suppressor mutations that might arise during strain construction

  • Comprehensive phenotypic analysis:

    • Employ multiple complementary assays for each phenotype

    • Establish quantitative metrics rather than qualitative observations

    • Perform time-course experiments to capture dynamic processes

  • Environmental variable control:

    • Standardize growth conditions, media composition, and cell density

    • Test multiple environmental conditions to identify context-dependent effects

    • Control for differences in growth phase and physiological state

  • Multi-laboratory validation:

    • Establish collaborative projects to test key findings across different laboratories

    • Share strains, protocols, and analytical tools

    • Develop consensus protocols for critical assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.