Recombinant Bacillus subtilis Protein liaI (liaI)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Protein liaI

Recombinant Bacillus subtilis Protein liaI (liaI) is a product of the liaIH operon, which plays a crucial role in the bacterial response to cell envelope stress. This operon is regulated by the LiaRS two-component system, which is activated in the presence of certain antibiotics. The protein itself is a small membrane protein that contributes to the bacterium's ability to withstand oxidative stress and antibiotic exposure, making it significant in both basic research and biotechnological applications.

Structure and Function of liaI

Protein Structure

LiaI is characterized as a membrane-associated protein that forms oligomeric structures. It shares functional similarities with phage shock proteins found in other bacteria, such as Escherichia coli. The structural properties of LiaI suggest that it plays a protective role within the bacterial cell envelope, particularly during stress conditions induced by antibiotics.

Functional Role

The primary functions of liaI include:

  • Protection Against Antibiotics: LiaI is part of the cellular response mechanism that protects against antibiotics targeting the cell wall.

  • Oxidative Stress Response: It also aids in protecting cells from oxidative damage, which can occur due to environmental stressors.

Expression Systems for Recombinant Production

LIKE System

The LIKE (LiaRS-controlled gene expression) system has been developed to facilitate the production of recombinant proteins in Bacillus subtilis. This system utilizes the liaI promoter (PliaI), which is tightly regulated and can be induced by specific antibiotics, leading to high levels of protein expression.

  • Advantages:

    • Tightly controlled expression during growth phases.

    • Rapid induction with a dynamic range of up to 1000-fold.

    • Utilizes commercially available inducers.

Expression Vectors

Two primary expression vectors have been constructed within this system:

  • pLIKE-int: An integrative vector for stable expression.

  • pLIKE-rep: A replicative vector allowing for higher yield production.

These vectors have been optimized through site-directed mutagenesis to enhance their performance in producing recombinant proteins like liaI.

Research Findings on liaI

Recent studies have highlighted several key findings regarding the function and regulation of liaI:

  • Induction Mechanism: The expression of liaI can be induced by sublethal concentrations of antibiotics, resulting in a significant increase in protein levels within minutes .

  • Proteomic Analysis: Comprehensive studies using proteomics have identified liaI as a critical target of the LiaR response, underscoring its importance in bacterial survival under antibiotic stress .

  • Functional Diversity: Comparative genomic analyses have shown that homologs of the liaIH operon are absent in certain Firmicutes, indicating a unique evolutionary adaptation among bacilli .

Table 1: Characteristics of Recombinant Bacillus subtilis Protein liaI

FeatureDescription
Protein NameRecombinant Bacillus subtilis Protein liaI
OperonliaIH
Molecular WeightApproximately 10 kDa
FunctionAntibiotic resistance, oxidative stress response
Induction MechanismAntibiotic-induced via LiaRS system

Table 2: Comparison of Expression Systems for Recombinant Proteins

SystemInduction TypeDynamic RangeAdvantages
LIKEAntibioticUp to 1000-foldTightly controlled, rapid response
TraditionalIPTG or Lac-basedModerateWell-established, widely used

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment to your requirements.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.

Synonyms
liaI; yvqI; BSU33130; Protein LiaI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
liaI
Target Protein Sequence
MKINKKTIGGFLLIVFGISVFFGGGSFGFIIPLAIGSLMTYAGIKRFAAGKTITGIIVGG IGAIMLICSLPFVVGIALAAAMVYYGWKLMKNGSADNGVSSFDPEPASAAYQSHFDDEWE EFLKKK
Uniprot No.

Target Background

Gene References Into Functions
  1. Research indicates that liaIH operon gene products contribute to cellular protection against oxidative stress and certain cell wall antibiotics. PMID: 20639339
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the LIKE expression system in Bacillus subtilis?

The LIKE (LIaRS-Controlled gene Expression) system is a novel expression technology developed for B. subtilis based on the liaI promoter (PliaI), which operates under control of the LiaRS antibiotic-inducible two-component system. This expression platform includes two primary vectors - the integrative pLIKE-int and the replicative pLIKE-rep . The system's primary advantages include a tightly switched-off promoter during exponential growth when no inducer is present, and a remarkably rapid response upon induction, with over 100-fold activity increase within just 10 minutes of exposure to cell wall antibiotics .

What makes Bacillus subtilis advantageous as a protein expression host?

B. subtilis offers multiple advantages as an expression host:

  • GRAS (generally recognized as safe) status making it suitable for various applications

  • Remarkable natural ability to absorb and incorporate exogenous DNA

  • Extensive scientific knowledge accumulated over decades regarding its biology

  • Capacity to secrete proteins directly into the growth medium

  • Ability to be grown to high cell densities

  • Potential for high protein yields (25 grams of protein per liter under optimized fermentation conditions)

How does the liaI promoter system respond to induction?

The liaI promoter exhibits highly distinctive induction characteristics:

ParameterPerformance
Response timeWithin 10 minutes of induction
Dynamic range>100-fold (up to 1000-fold)
Activation mechanismCell wall antibiotic exposure
Response profileFast but transient
RegulationConcentration-dependent activation

This promoter remains tightly inactive without a stimulus but shows concentration-dependent activation when exposed to appropriate inducers, allowing researchers to modulate expression levels by adjusting inducer concentration .

What are the key components of the Bacillus subtilis secretion pathway?

The B. subtilis secretion pathway incorporates several essential elements, particularly for proteins containing signal peptides (SPs). These SPs display a conserved structure consisting of:

  • A positively charged N-terminal region containing lysine/arginine residues

  • A central H-region composed primarily of hydrophobic residues capable of adopting α-helical conformation

  • A hydrophilic C-region featuring a type I signal peptidase recognition site with the Ala-x-Ala consensus motif

The C-region adopts a β-stranded conformation allowing recognition and subsequent cleavage by multiple type I signal peptidases (SipS-SipW) in B. subtilis . Understanding these components is crucial when designing expression constructs for secreted proteins.

What optimization strategies enhance expression in the LIKE system?

Several sophisticated approaches can optimize the LIKE system performance:

Ribosome Binding Site Engineering:
Site-directed mutagenesis can optimize the ribosome binding site and alter its spacing relative to the initiation codon. These genetic modifications significantly impact protein production yield, as demonstrated using GFP as a model protein .

Host Strain Engineering:
Construction of tailored B. subtilis expression strains containing specific markerless chromosomal deletions of the liaIH region can:

  • Prevent undesired background protein production

  • Enhance the positive autoregulation of the LiaRS system

  • Substantially increase target gene expression from the PliaI promoter

Strategic Inducer Selection:
The system offers flexibility in inducer selection with commercially available, affordable options. Unlike IPTG-based systems where the inducer isn't consumed by bacteria, researchers must consider inducer characteristics when developing expression protocols .

What are the major bottlenecks in the B. subtilis secretion pathway and how can they be addressed?

Several critical bottlenecks can limit recombinant protein secretion in B. subtilis:

BottleneckDescriptionPotential Solutions
Proteolytic degradationB. subtilis naturally secretes multiple proteasesUse protease-deficient strains (up to 10 protease deletions available)
Membrane targetingIssues with recognition of signal peptidesOptimize signal peptides for specific target proteins
Translocation efficiencyLimitations in protein passage through membraneEngineer components of the Sec translocation machinery
Post-translocation foldingChallenges in correct protein folding after secretionCo-express appropriate chaperones, optimize culture conditions

Despite development of strains lacking up to ten different proteases, proteolytic degradation remains incompletely solved, as detailed in supplementary materials of the referenced literature . Researchers must carefully consider these bottlenecks when designing expression strategies.

How does the LIKE system compare to other inducible systems in B. subtilis?

The LIKE system offers distinct advantages compared to other commonly used inducible systems:

CharacteristicliaI Promoter (LIKE)IPTG-InducibleXylose-Inducible
Induction timeExtremely rapid (<10 min)30-60+ minModerate
Dynamic rangeVery high (>100-fold, up to 1000-fold)Typically 10-50 foldVariable
Leaky expressionMinimalCan be significantModerate
Response profileTransientSustainedSustained
Inducer economicsAffordableExpensiveAffordable
Strain conversionEasily converted to constitutive expressionLimited conversion optionsLimited conversion options

A notable aspect of the LIKE system is its capacity for convenient conversion from inducible expression strains into strong constitutive protein production factories . This flexibility provides researchers with multiple expression strategies within a single system.

What methodological considerations are critical when designing experiments with the liaI system?

When implementing the liaI system, researchers should methodically address:

Induction Protocol Development:

  • Determine optimal induction timing relative to growth phase

  • Establish dose-response curves for selected inducers

  • Consider the transient nature of the response and whether repeated inducer addition is necessary

Vector Selection Strategy:

  • Choose between integrative (pLIKE-int) or replicative (pLIKE-rep) vectors based on stability requirements

  • Consider chromosomal integration for long-term production strains

Expression Monitoring Approach:

  • Implement real-time monitoring systems (e.g., GFP fusion proteins)

  • Develop sampling protocols that capture the rapid but transient response profile

  • Utilize quantitative methods to determine optimal harvest timing

Scale-up Considerations:

  • Ensure consistent inducer distribution in larger volumes

  • Monitor critical parameters (pH, oxygen) that might affect the LiaRS system

  • Develop appropriate feeding strategies if sustained production is required

How can advanced molecular biology techniques enhance liaI-based expression?

Sophisticated molecular approaches can significantly improve liaI-based systems:

CRISPR-Cas9 Engineering:
Precise genome modifications can remove competing pathways, eliminate unnecessary genes, or modify regulatory elements affecting the liaI system.

Synthetic Biology Approaches:
Development of synthetic hybrid promoters incorporating liaI elements can create expression systems with customized regulatory properties .

Amber Suppression Technology:
The technology pioneered by Scheidler et al. for incorporating non-canonical amino acids (ncAAs) could potentially be adapted to the liaI system, enabling production of proteins with bio-orthogonal groups suitable for chemical modification .

Signal Peptide Engineering:
Optimization of signal peptides specifically for the target protein can significantly improve secretion efficiency, focusing on the critical N-terminal positive charge region, hydrophobic core, and C-terminal peptidase recognition site .

What types of proteins have been successfully expressed using liaI-based systems?

The LIKE system has demonstrated versatility in protein expression, though comprehensive catalogs of expressed proteins aren't provided in the search results. The system has been validated using GFP as a model protein to assess the impact of genetic modifications on expression yield . Given the system's properties, it appears particularly suitable for:

  • Proteins requiring tight regulation prior to induction

  • Applications requiring rapid protein production responses

  • Proteins that benefit from transient rather than sustained expression

  • Situations where conversion to constitutive expression may be advantageous

What emerging research directions might enhance liaI-based expression systems?

Several promising research directions could further advance liaI-based expression:

Multi-omics Integration:
Combining transcriptomics, proteomics, and metabolomics approaches to comprehensively understand and optimize the system's performance.

Secretion Pathway Engineering:
Developing improved understanding and engineering of secretion pathways to overcome current bottlenecks, particularly for complex proteins with multiple subunits .

Synthetic Regulatory Circuits:
Creating synthetic regulatory networks that incorporate the liaI promoter within more complex expression control systems.

Continuous Processing Applications:
Developing continuous cultivation systems that leverage the rapid induction characteristics of the liaI promoter for on-demand protein production.

What induction protocol optimizations are recommended for the liaI system?

The following protocol optimization steps are recommended:

  • Growth Phase Determination:

    • Monitor culture OD600 and determine optimal induction point (typically early-mid exponential phase)

    • Record baseline expression levels pre-induction

  • Inducer Concentration Optimization:

    • Perform dose-response experiments with at least 5 concentrations of selected cell wall antibiotics

    • Measure protein expression at 10-minute intervals post-induction

    • Create response curves to identify optimal inducer concentration

  • Harvest Timing Optimization:

    • Given the transient nature of the response, determine precise optimal harvest timing

    • Consider repeated inducer addition if sustained expression is required

  • Temperature Effects Assessment:

    • Test induction at different temperatures (25°C, 30°C, 37°C)

    • Determine if lower temperatures extend the expression window

What troubleshooting strategies address common issues with the liaI system?

IssuePotential CausesTroubleshooting Strategies
Low expressionSuboptimal RBS, poor inductionOptimize RBS, increase inducer concentration, verify inducer efficacy
Premature induction declineNatural transient responseConsider repeated inducer addition, optimize harvest timing
Protein degradationProtease activityUse protease-deficient strains, add protease inhibitors, optimize growth conditions
Variable expressionInconsistent inductionStandardize culture conditions, verify inducer distribution
Loss of expression over generationsGenetic instabilityUse integrative vectors, confirm insertion stability

When inconsistent results occur, researchers should systematically evaluate each component of the expression system, from strain integrity to inducer quality to environmental conditions.

How does B. subtilis compare to other bacterial expression hosts?

Comparing B. subtilis to other common expression hosts reveals distinct advantages and limitations:

FeatureB. subtilisE. coliL. lactis
Secretion capacityHighLimitedModerate
Protease issuesSignificantMinimalMinimal
Max protein yieldVery high (25 g/L)Very highLower (~100-fold less)
Growth densityVery highVery highLower
GRAS statusYesNoYes
Codon optimizationOften neededOften neededOften needed
Endotoxin concernsNoneSignificantNone

Despite L. lactis having advantages as a non-proteolytic alternative, B. subtilis can achieve approximately 100-fold higher protein yields at laboratory scale . Under optimized fermentation conditions, B. subtilis can produce up to 25 g/L of protein compared to significantly lower yields with L. lactis .

What are the environmental and economic considerations for liaI-based systems?

The liaI system offers several economic and environmental advantages:

  • Inducer Economics: Uses affordable cell wall antibiotics rather than expensive chemicals like IPTG

  • Conversion Potential: Strains can be converted to constitutive expression, eliminating ongoing inducer costs

  • Growth Requirements: B. subtilis grows efficiently on simple media, reducing production costs

  • Downstream Processing: Secretion directly into media can simplify purification processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.