Recombinant Bacillus subtilis Protein lplB (lplB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bacillus subtilis Protein LplB (lplB)

LplB is a lipoprotein encoded by the lplB gene in B. subtilis. According to UniProt (ID: P39128), LplB is annotated as a membrane-associated lipoprotein involved in cellular processes, though its precise biochemical role remains understudied. Recombinant LplB production leverages B. subtilis’s efficient secretion machinery and genetic tractability .

Production Strategies for Recombinant LplB

Key steps in producing recombinant LplB align with established B. subtilis protein expression workflows :

  1. Vector Design:

    • Promoters: Constitutive (e.g., P43, Pgrac) or inducible (e.g., IPTG, xylose) promoters drive expression .

    • Signal Peptides: Optimized sequences (e.g., SacB, AmyQ) enhance secretion efficiency .

    • Tags: His-tags simplify purification .

  2. Host Strain Selection:

    • Protease-deficient strains (e.g., WB800) minimize degradation .

    • GRAS status ensures suitability for industrial applications .

  3. Fermentation Optimization:

    • Medium composition, pH, and feeding strategies maximize yield .

Key Challenges and Solutions

ChallengeSolutionSource
Proteolytic degradationUse of protease-deficient strains (e.g., WB600)
Low secretion efficiencySignal peptide screening libraries (94 variants)
Protein misfoldingCo-expression of chaperones (e.g., GroEL/GroES)

Analytical Data for Recombinant LplB

While direct data on LplB is scarce, analogous recombinant proteins in B. subtilis provide benchmarks:

ProteinYieldHost StrainTagPurityReference
RPLB (50S ribosomal L2)N/AWB800His-tag>80% (SDS)
Microbial transglutaminase63.0 ± 0.6 mg/L168 (ATCC)NoneN/A

Applications and Future Directions

  • Industrial Enzymes: Lipoproteins like LplB may serve in biocatalysis or biofuel production.

  • Therapeutics: Secretion systems enable scalable production of bioactive proteins .

  • Research Tools: His-tagged LplB facilitates structural studies .

Future work should prioritize lplB-specific optimization, including promoter engineering and proteomic profiling .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lplB; BSU07110; Protein LplB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
lplB
Target Protein Sequence
METVPKKRDAPVLTAGKGISWMAALKRDKWLYLLLIPGLLYFLIFKYLPMWGVLIAFKDY SPYLGFWKSEWVGFDYFKDFFMNPDFFRLLRNTLMLASLDLLFAFPAPLILALLLNEVRK AVYKRCIQTFIYVPHFVSWTIVVSITFVFFTVDTGVINKLIMSLTGEQISFLSDADWFRP MIVMQSIWKETGWGTILFLAALATVDQEQYEAAIMDGAGRFRRMWHITLPAIRSTIIVLL ILRIGSFLNLGFEQVYLMTNSLNRSVADIFDTYVYMMGITQGAYSYSTAVGLFKSVVGII LIFGANYIAKKFDQEGLF
Uniprot No.

Target Background

Database Links
Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus subtilis lplB protein and why is it studied in recombinant systems?

While specific information about lplB protein is limited in the current literature, recombinant protein expression in B. subtilis offers significant advantages for protein characterization and functional studies. B. subtilis is particularly valuable as an expression host because it facilitates both soluble and secretory expression, especially for proteins with complex structures such as those containing disulfide bonds . Unlike E. coli expression systems, recombinant proteins produced in B. subtilis are free of endotoxin, making them suitable for various applications requiring high purity . For studying proteins like lplB, the B. subtilis system enables direct secretion into the fermentation broth, simplifying downstream purification processes and potentially maintaining the protein in its native conformation.

What are the key advantages of using B. subtilis for recombinant lplB protein expression?

B. subtilis offers several distinct advantages as an expression system for recombinant proteins like lplB:

  • Direct secretion into the growth medium, eliminating the need for cell disruption and simplifying purification .

  • Endotoxin-free protein production, unlike E. coli-based systems .

  • Capability to handle proteins with complex structures that require proper folding and disulfide bond formation .

  • High secretion capacity, with yields reaching gram-per-liter range under optimized fermentation conditions (up to 25 g/L) .

  • Well-characterized secretion machinery with multiple engineering options to improve protein yields .

  • GRAS (Generally Recognized As Safe) status, making it suitable for producing proteins for various applications .

These characteristics make B. subtilis particularly useful for the expression of proteins like lplB that may benefit from secretory expression and proper folding in a Gram-positive bacterial environment.

How do I select an appropriate signal peptide for efficient secretion of recombinant lplB?

The selection of an appropriate signal peptide is critical for efficient secretion of recombinant proteins, including lplB. Research has shown that the level of secretion is significantly influenced by the type of signal peptide used . For optimal signal peptide selection, consider the following methodology:

  • Utilize a screening system like the B. subtilis Secretory Protein Expression System that allows testing of multiple signal peptides simultaneously .

  • Test the target protein with various signal peptides from a library of B. subtilis-derived secretory signal peptides (such libraries often contain 173 different types of signal peptides) .

  • Construct expression plasmids using a shuttle vector system like pBE-S DNA that functions in both E. coli and B. subtilis .

  • Transform these constructs into an appropriate B. subtilis strain (e.g., proteases-deficient strains like RIK1285) .

  • Analyze the culture supernatant to identify the signal peptide that yields the highest secretion level of the target protein.

What strain of B. subtilis is recommended for recombinant lplB expression?

For recombinant protein expression, including hypothetical lplB expression, proteases-deficient B. subtilis strains are strongly recommended. These strains prevent degradation of the target protein during expression and secretion. Based on the literature, several established protease-deficient strains have been developed:

  • DB104 (∆aprE, ∆nprE) - lacking two major extracellular proteases .

  • WB600 (∆nprE, ∆aprE, ∆epr, ∆bpr, ∆mpr, ∆nprB) - lacking six extracellular proteases .

  • WB700 (WB600 ∆vpr) - lacking seven proteases .

  • WB800 (WB700 ∆wprA) - lacking eight proteases .

  • BRB strain collection - strains lacking up to ten extracytoplasmic and/or secreted proteases .

  • RIK1285 - a commercially available strain deficient in two kinds of proteases, specifically developed for secretory expression .

What are the potential bottlenecks in the Sec secretion pathway that might affect lplB secretion in B. subtilis?

The Sec secretion pathway in B. subtilis has several potential bottlenecks that could impact the efficient secretion of recombinant proteins like lplB. Understanding these bottlenecks is crucial for pathway engineering to enhance protein yields:

Addressing these bottlenecks through genetic engineering approaches has proven successful in increasing secretion efficiency. For example, overexpression of components like SecA, PrsA, or signal peptidases has been shown to enhance the secretory capacity of B. subtilis .

How can I optimize codon usage for improved expression of lplB in B. subtilis?

Optimizing codon usage is a critical step for enhancing recombinant protein expression in B. subtilis. For lplB expression, consider the following methodological approach:

  • Analyze native codon usage patterns: Examine the codon usage bias in highly expressed B. subtilis genes, focusing on those that are naturally secreted.

  • Calculate Codon Adaptation Index (CAI): Use bioinformatics tools to calculate the CAI for your native lplB sequence and identify codons that may limit expression efficiency.

  • Design synthetic gene with optimized codons: Replace rare codons with those frequently used in highly expressed B. subtilis genes, while maintaining the amino acid sequence.

  • Consider mRNA secondary structure: Beyond codon optimization, ensure that the optimized sequence does not form stable secondary structures at the 5' end of the mRNA that could impede translation initiation.

  • Avoid introducing unintended regulatory elements: Check the optimized sequence for inadvertent introduction of regulatory elements like Shine-Dalgarno-like sequences or transcription terminators.

  • Experimentally validate: Test both native and codon-optimized versions of lplB to quantify the improvement in expression levels.

Codon optimization can significantly impact expression levels, especially for proteins originated from organisms with different GC content or codon preferences than B. subtilis. In some cases, optimization has been reported to increase protein yields by more than 10-fold.

What are the differences in secretory protein expression between B. subtilis and Lactococcus lactis for lplB production?

B. subtilis and Lactococcus lactis represent two different Gram-positive bacterial platforms for recombinant protein secretion, each with distinct characteristics that might affect lplB production:

FeatureB. subtilisL. lactisImplications for lplB
Production yieldHigh (gram per liter range, up to 25 g/L under optimized conditions)Significantly lower (approximately 100-fold less at laboratory scale)B. subtilis likely provides higher lplB yields
Growth densityCan reach high cell densitiesLower maximum cell density; acidifies growth mediumB. subtilis allows for more concentrated production
Proteolytic activityHigh (produces multiple extracellular proteases)Low (minimally proteolytic)L. lactis may preserve lplB integrity better if protease-sensitive
Secretion capacityMultiple secretion pathways with high capacityMore limited secretion capacityB. subtilis offers more options for secretion pathway engineering
Quality controlMore stringent, but can lead to degradationLess degradation of improperly folded proteinsL. lactis might be better for difficult-to-fold variants of lplB
Strain engineeringExtensively engineered strains availableLimited engineered strains, but simpler systemB. subtilis offers more engineering options but L. lactis has a cleaner background

While B. subtilis is generally preferred for bulk production of recombinant proteins, L. lactis might be advantageous in specific scenarios, particularly if lplB is highly susceptible to proteolytic degradation or has complex folding requirements . For high-quality, small-scale production (e.g., for structural studies or specific applications requiring high purity), L. lactis could be considered, while B. subtilis would be the system of choice for larger-scale production .

How can genome engineering approaches improve lplB expression in B. subtilis?

Advanced genome engineering approaches offer promising strategies to enhance lplB expression in B. subtilis beyond conventional strain modifications:

  • Genome minimization (mini-Bacillus): Recent developments in genome reduction have led to the creation of minimal B. subtilis strains with substantially reduced genomes . These mini-Bacillus strains have fewer competing pathways and reduced metabolic burdens, potentially allowing more cellular resources to be directed toward lplB production. This approach has shown promise for improving protein secretion efficiency and reducing background contaminants .

  • Non-classical secretion pathways: Exploration of alternative "non-classical" protein secretion routes that bypass the traditional Sec-dependent pathway offers new opportunities . For example, fusion of lplB to D-psicose 3-epimerase from Ruminococcus sp. has been shown to enable Sec-independent protein secretion . This approach could be particularly valuable if lplB faces secretion bottlenecks in the conventional pathway.

  • Global transcription machinery engineering (gTME): This approach involves modifying transcription factors or RNA polymerase to alter global gene expression patterns, potentially increasing capacity for recombinant protein production.

  • Chassis cell engineering: Systematic modification of cellular systems like metabolic pathways, stress response mechanisms, and quality control systems can create a more hospitable environment for recombinant protein production.

  • Integration of heterologous secretion components: Engineering B. subtilis to express secretion machinery components from other organisms might overcome species-specific limitations. For example, incorporating elements from the L. lactis secretion system that handle certain protein types more efficiently.

Implementing these advanced genome engineering approaches requires sophisticated genetic tools and comprehensive understanding of B. subtilis physiology, but they offer significant potential for overcoming traditional limitations in recombinant protein production.

What is the optimal protocol for purifying secreted lplB from B. subtilis culture supernatant?

Purification of secreted recombinant proteins from B. subtilis culture supernatant requires a strategic approach to achieve high purity and yield. For lplB purification, the following methodological protocol is recommended:

  • Culture harvesting and initial clarification:

    • Cultivate transformed B. subtilis in appropriate medium (typically for 24-48 hours at 37°C) .

    • Harvest culture by centrifugation (6,000-10,000 × g for 15-20 minutes at 4°C) to separate cells from supernatant.

    • Filter the supernatant through a 0.22 μm filter to remove any remaining cells and debris.

  • Concentration of target protein:

    • Depending on expression level, concentrate the supernatant using ammonium sulfate precipitation (typically 60-80% saturation) or tangential flow filtration.

    • If using ammonium sulfate precipitation, resuspend the precipitate in a minimal volume of appropriate buffer.

  • Affinity chromatography:

    • If the lplB protein was expressed with a His-tag (as supported by the pBE-S vector system) , use immobilized metal affinity chromatography (IMAC).

    • Equilibrate a Ni-NTA or similar column with binding buffer (typically containing 20-50 mM imidazole).

    • Load the concentrated sample and wash extensively to remove non-specifically bound proteins.

    • Elute the target protein with increasing imidazole concentration (typically 250-500 mM).

  • Secondary purification (if needed):

    • Depending on the purity requirements, employ size exclusion chromatography or ion exchange chromatography as a polishing step.

    • For size exclusion, select a column with an appropriate fractionation range for lplB.

    • For ion exchange, determine the theoretical pI of lplB and select an appropriate resin and pH conditions.

  • Buffer exchange and concentration:

    • Dialyze or use centrifugal concentrators to exchange the buffer to one suitable for downstream applications.

    • Concentrate to desired concentration while monitoring for aggregation.

  • Quality control assessment:

    • Verify purity by SDS-PAGE and/or Western blotting.

    • Confirm identity by mass spectrometry.

    • Assess activity using appropriate functional assays specific to lplB.

Note that the advantage of the B. subtilis secretion system is that the target protein is directly secreted into the culture medium, significantly simplifying the initial extraction steps compared to cytoplasmic expression systems .

How can I monitor and quantify lplB secretion during B. subtilis fermentation?

Effective monitoring and quantification of lplB secretion during B. subtilis fermentation is essential for process optimization. Several complementary methods can be employed:

  • SDS-PAGE analysis of culture supernatant:

    • Collect samples at regular intervals during fermentation.

    • Centrifuge at 10,000 × g for 5 minutes to remove cells.

    • Precipitate proteins from supernatant with trichloroacetic acid (TCA, final concentration 10-15%).

    • Analyze by SDS-PAGE with Coomassie or silver staining.

    • For quantification, use densitometry with known standards of purified protein .

  • Western blotting:

    • Transfer proteins from SDS-PAGE to PVDF or nitrocellulose membrane.

    • Detect using antibodies specific to lplB or to the affinity tag (e.g., His-tag).

    • Particularly useful when expression levels are low or complex background is present.

  • Enzyme-linked immunosorbent assay (ELISA):

    • Develop a sandwich ELISA using antibodies specific to lplB.

    • Allows precise quantification of target protein concentration.

    • Suitable for high-throughput analysis of multiple samples.

  • Functional assays:

    • If lplB has measurable enzymatic activity or binding capacity, develop specific activity assays.

    • Activity measurements can provide information about not just quantity but also quality (properly folded, active protein).

  • Fluorescent protein fusion for real-time monitoring:

    • For research purposes, lplB can be fused with a fluorescent protein.

    • Allows real-time, non-invasive monitoring of secretion.

    • Fluorescence intensity in supernatant can be measured spectrofluorometrically.

  • Mass spectrometry-based quantification:

    • For absolute quantification, develop a multiple reaction monitoring (MRM) or parallel reaction monitoring (PRM) method.

    • Select signature peptides unique to lplB.

    • Use isotopically labeled synthetic peptides as internal standards.

When monitoring secretion, it's important to also track cell density (OD600), pH, and other fermentation parameters to correlate production with growth phase and culture conditions. This comprehensive monitoring approach enables informed decision-making for process optimization and scale-up.

What fermentation conditions optimize lplB secretion in B. subtilis?

Optimizing fermentation conditions is crucial for maximizing lplB secretion in B. subtilis. Based on established protocols for recombinant protein production, the following parameters should be considered:

  • Media composition:

    • Rich media (like 2xYT or Super Broth) typically support higher protein yields.

    • Defined media may provide more consistent results and simplify downstream processing.

    • Supplement with calcium ions (1-5 mM CaCl₂) to enhance stability of cell wall structures and reduce autolysis .

    • Include appropriate selective antibiotic (e.g., kanamycin at 10 μg/ml) .

  • Growth parameters:

    • Temperature: Typically 30-37°C during growth phase; consider lowering to 25-30°C during production phase to reduce proteolytic activity and improve folding.

    • pH: Maintain at 7.0-7.5 using automated pH control systems.

    • Aeration: High dissolved oxygen levels (>30% saturation) generally improve protein secretion.

    • Agitation: 200-400 rpm in shake flasks; in bioreactors, adjust to maintain target dissolved oxygen.

  • Induction timing and strategy:

    • For constitutive promoters (like the subtilisin promoter in the pBE-S system), no induction is required .

    • Optimal harvest time typically ranges from 24-48 hours after inoculation .

    • For inducible promoters, induce at mid-log phase (OD600 ~0.8-1.2) for optimal balance between cell density and metabolic capacity.

  • Feed strategy for high-density cultivation:

    • Implement fed-batch strategy to reach higher cell densities while avoiding overflow metabolism.

    • Carbon source feeding can be based on dissolved oxygen signals (DO-stat) or predefined exponential feeding rates.

    • Consider supplementary feeding of amino acids or peptides to support high-level protein synthesis.

  • Scale-up considerations:

    • Maintain consistent oxygen transfer rate (OTR) and mixing time across scales.

    • Adjust feeding strategies to account for changing mixing dynamics.

    • Monitor and control foam formation, which can be problematic at larger scales.

Under optimized fermentation conditions, B. subtilis has been reported to produce up to 25 grams of recombinant protein per liter of culture , demonstrating the significant production capacity of this expression system when properly optimized.

How can I address proteolytic degradation of secreted lplB in B. subtilis cultures?

Proteolytic degradation is one of the most common challenges in recombinant protein production with B. subtilis. To address this issue for lplB expression, implement the following strategies:

  • Use protease-deficient strains:

    • Select highly engineered strains like WB800 (lacking 8 proteases) or strains from the BRB collection (lacking up to 10 proteases) .

    • For commercial applications, consider using RIK1285, which is deficient in two proteases and specifically designed for secretory expression .

  • Optimize culture conditions to minimize protease activity:

    • Lower the cultivation temperature to 25-30°C during the production phase.

    • Maintain pH between 7.0-7.5, as some proteases have higher activity at extreme pH values.

    • Harvest cultures earlier, as protease accumulation typically increases in late stationary phase.

  • Add protease inhibitors to culture medium:

    • Include EDTA (1-5 mM) to inhibit metalloproteases.

    • Add phenylmethylsulfonyl fluoride (PMSF, 0.1-1 mM) or other serine protease inhibitors.

    • Note that protease inhibitors may affect cell growth and should be tested carefully.

  • Protein engineering approaches:

    • Identify and modify protease-sensitive sites in lplB through site-directed mutagenesis.

    • Add stabilizing domains or fusion partners that can protect vulnerable regions.

  • Alternative secretion pathways:

    • Explore non-classical secretion routes that may bypass exposure to certain proteases .

    • Test different signal peptides which may direct the protein through pathways with less proteolytic activity .

  • Process optimization:

    • Implement continuous removal of the secreted protein from the culture supernatant during fermentation.

    • Consider perfusion cultivation systems that constantly remove secreted products.

  • Monitor and validate improvements:

    • Use pulse-chase experiments with labeled proteins to track degradation rates.

    • Perform time-course analysis of culture supernatants to identify when degradation begins.

It's important to note that while protease-deficient strains reduce degradation, they may be more prone to autolysis, which can lead to contamination with cytoplasmic proteins . Therefore, optimization might require balancing between protease deficiency and strain stability.

What strategies can overcome secretion stress responses when expressing lplB in B. subtilis?

When expressing recombinant proteins like lplB at high levels, B. subtilis often activates secretion stress responses that can limit production. These responses include the CssRS two-component system that upregulates quality control proteases like HtrA and HtrB. Overcoming these stress responses requires multi-faceted approaches:

  • Engineering secretion stress response pathways:

    • Consider deletion or modification of the cssRS genes to attenuate the stress response.

    • Delete or downregulate htrA and htrB genes encoding quality control proteases, but note this may lead to accumulation of misfolded proteins.

  • Co-expression of folding modulators:

    • Overexpress the extracytoplasmic folding catalyst PrsA, which has been shown to enhance secretion of various recombinant proteins .

    • For proteins containing disulfide bonds, co-express thiol-disulfide oxidoreductases (BdbB-D in B. subtilis) .

  • Secretion machinery enhancement:

    • Overexpress secA, secDF, or other components of the Sec translocon to increase secretion capacity .

    • Consider expression of heterologous secretion components, such as secDF from other species, which has shown success in some cases .

  • Signal peptide optimization:

    • Screen different signal peptides to identify those that cause minimal secretion stress .

    • Engineer signal peptides to improve targeting efficiency while reducing cellular stress responses.

  • Induction strategy optimization:

    • Implement slower, controlled induction to prevent overwhelming the secretion machinery.

    • Consider auto-induction systems or fed-batch strategies that balance protein production with secretion capacity.

  • Culture condition adjustments:

    • Lower cultivation temperature during expression phase to slow down protein synthesis and allow more time for proper folding and secretion.

    • Add chemical chaperones to the culture medium (e.g., glycerol, TMAO) that can stabilize protein folding.

  • Genetic background modifications:

    • Consider global transcription machinery engineering to alter stress response patterns.

    • Modify central carbon metabolism to ensure sufficient energy supply for protein secretion.

Implementing these strategies typically requires an iterative approach, as the effectiveness of each method may depend on the specific properties of the lplB protein and the expression conditions used.

How can CRISPR-Cas9 genome editing enhance B. subtilis as an expression system for proteins like lplB?

CRISPR-Cas9 genome editing represents a revolutionary tool for improving B. subtilis as an expression host for recombinant proteins like lplB. This technology enables precise genetic modifications that were previously challenging or impossible, opening new avenues for strain engineering:

  • Multiplex genome editing:

    • CRISPR-Cas9 allows simultaneous modification of multiple genomic loci in a single transformation.

    • This capability enables rapid construction of strains with multiple protease deletions, secretion machinery enhancements, and metabolic optimizations.

    • For lplB expression, this could mean simultaneous removal of several proteases while enhancing folding factors like PrsA.

  • Promoter engineering:

    • CRISPR-based methods can be used to replace native promoters with synthetic or engineered variants.

    • Precise tuning of expression levels for secretion machinery components can optimize the secretion capacity.

    • Integration of orthogonal expression systems controlled by inducible promoters allows fine control over lplB production timing.

  • Genomic integration optimization:

    • Identify and target optimal genomic loci for integration of lplB expression cassettes.

    • Create libraries of integration sites and test for expression efficiency and stability.

    • Compare performance of different copy numbers and integration positions.

  • Efficient pathway engineering:

    • Redirect metabolic flux to provide sufficient energy and building blocks for high-level protein secretion.

    • Modify or remove competing secretory pathways to prioritize lplB secretion.

    • Engineer specialized cellular compartments dedicated to recombinant protein production.

  • Base editing applications:

    • CRISPR-based base editors allow for precise nucleotide substitutions without double-strand breaks.

    • This capability enables fine-tuning of ribosome binding sites, transcription factor binding sites, and other regulatory elements.

    • Systematic modification of translation initiation regions can optimize translation efficiency of lplB.

  • Minimal genome construction:

    • CRISPR technologies facilitate the creation of minimal genomes through large deletions.

    • Building on the mini-Bacillus concept , develop custom-designed chassis with only essential genes and those specifically needed for lplB production.

    • Remove genetic elements that compete for cellular resources without contributing to target protein production.

CRISPR-Cas9 technologies represent a quantum leap in our ability to precisely engineer B. subtilis strains for specialized applications like lplB production, enabling previously unattainable levels of control and efficiency in recombinant protein expression systems.

What synthetic biology approaches are being developed to enhance recombinant protein secretion in B. subtilis?

Synthetic biology is dramatically expanding the toolkit available for enhancing recombinant protein secretion in B. subtilis, with several innovative approaches that could be applied to lplB production:

  • Synthetic secretion pathways:

    • De novo design and implementation of orthogonal secretion pathways that function independently from native cellular systems.

    • Engineering of hybrid secretion systems combining elements from different organisms to bypass traditional bottlenecks.

    • Development of synthetic translocases with increased efficiency or altered specificity for recombinant proteins.

  • Cell-free expression systems based on B. subtilis:

    • Creation of B. subtilis-derived cell-free protein synthesis systems optimized for secretory proteins.

    • Incorporation of artificial membranes and complete secretion machinery components.

    • These systems eliminate cellular growth constraints and allow direct manipulation of the biochemical environment.

  • Secretion-enhancing genetic circuits:

    • Design of genetic circuits that sense secretion stress and dynamically respond by adjusting expression levels.

    • Implementation of feed-forward loops that pre-emptively upregulate chaperones and folding factors before high-level expression begins.

    • Creation of toggle switches that allow temporal separation of growth and production phases.

  • Non-canonical secretion mechanisms:

    • Exploitation and engineering of "non-classical" protein secretion routes that bypass the traditional Sec pathway .

    • Development of synthetic nanotubes or vesicle-based secretion mechanisms.

    • Engineering chimeric proteins that leverage alternative translocation methods.

  • Artificial mini-cells dedicated to secretion:

    • Creation of specialized mini-cells with simplified genomes focused almost exclusively on protein secretion.

    • These would build upon the mini-Bacillus concept but with further specialization for secretory functions.

    • Compartmentalization of different production stages in separate cell types within a synthetic consortium.

  • Biomaterial-cell hybrids:

    • Integration of synthetic materials with living B. subtilis cells to create hybrid systems.

    • Development of artificial secretion pores embedded in the cell wall to facilitate protein export.

    • Creation of extracellular matrices that protect secreted proteins from degradation and facilitate recovery.

These synthetic biology approaches represent the cutting edge of recombinant protein production research and offer exciting possibilities for overcoming traditional limitations in B. subtilis expression systems. While many of these technologies are still in development, they point toward a future where protein secretion systems are increasingly engineered from the ground up rather than simply modified from their natural state.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.