Recombinant Bacillus subtilis Protein lplC (lplC)

Shipped with Ice Packs
In Stock

Description

Definition and Context

Recombinant lplC refers to the protein product of the lplC gene produced via genetic engineering in Bacillus subtilis. This protein is associated with optimizing cellular processes that improve recombinant protein yields. Bacillus subtilis is widely used as a microbial cell factory due to its GRAS (Generally Recognized as Safe) status, efficient secretion systems, and adaptability to large-scale fermentation .

Role in Recombinant Protein Expression

The lplC gene was identified as a key target in a genome-wide CRISPR interference (CRISPRi) screening study aimed at enhancing recombinant protein production in Bacillus subtilis. When activated via CRISPR activation (CRISPRa), lplC increased extracellular enzyme activity by 52.1% for a model polyunsaturated fatty acid (Pfa) enzyme . This suggests lplC may influence pathways critical to protein folding, secretion, or stress response.

Key Findings from CRISPRa Screening:

Gene TargetedEnzyme Activity IncreaseProposed Mechanism
murR77.4%Cell wall synthesis regulation
lplC52.1%Undetermined (hypothesized chaperone or secretion role)
hrcA23.0%Transcriptional repression of heat shock proteins

Research Implications

  • CRISPR-Based Engineering: The CRISPRa activation of lplC demonstrates its potential as a genetic lever for optimizing B. subtilis as a protein production host. This aligns with broader efforts to enhance secretion pathways, folding catalysts (e.g., PrsA), and protease-deficient strains .

  • Protease Sensitivity: While B. subtilis secretes proteases that degrade recombinant proteins, strains engineered with upregulated lplC could mitigate instability issues, as seen in other protease-deficient mutants .

Applications and Future Directions

Recombinant lplC’s utility lies in its role as a production enhancer rather than a standalone therapeutic or industrial enzyme. Future research should prioritize:

  • Structural and functional characterization of lplC.

  • Mechanistic studies to clarify its interaction with secretion pathways (e.g., Sec or Tat systems).

  • Integration into multi-gene engineering strategies, such as combined overexpression of chaperones (e.g., DnaK, PrsA) and lplC .

Challenges and Considerations

  • Limited Data: Current literature lacks detailed biochemical analyses of lplC, necessitating further validation.

  • Host Strain Optimization: Protease activity and cell wall composition (e.g., d-alanylation) significantly impact recombinant protein stability, requiring coordinated genetic modifications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any special requirements you may have. Please specify your desired format in the order notes and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this in advance and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
lplC; BSU07120; Protein LplC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
lplC
Target Protein Sequence
MAEIHTMHNTKAGRVFDVCNILFLGGVGAITILPFLYIIAGSFATEAELAQRSFFIFPKT FTLDAYKYVFSTPTFLRSMGVSIFITVVGTAVQLFFTFTMAYPLAKRHVKGRNLLLNLVI FSMLFSGGMIPTYLVVKSLGLLDTYWALILPMAINPFNLIIIKNFFQQLPRELEESAKID GCSEIGVFWRIALPLSKPVIATFALFYAVGIWNDFFHALLYINDSAKWPLQMVLRQVTIL SDLTATNGDTMQNAVPPEQGIKLAVIVIATLPILAVYPFLQKHFAKGMLIGSVKG
Uniprot No.

Target Background

Database Links
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is lplC protein and what is its function in Bacillus subtilis?

lplC (UniProt ID: P39129) is an ABC transporter permease in Bacillus subtilis with the gene ID 938767. It functions as a membrane component of an ABC transport system, facilitating the movement of specific molecules across the cell membrane. The protein plays a crucial role in the bacterium's cellular transport processes, particularly in the ATP-binding cassette (ABC) transport system, which is responsible for the import or export of various substrates against a concentration gradient using energy from ATP hydrolysis .

What expression systems are typically used for recombinant lplC production?

Recombinant lplC protein is commonly expressed using either E. coli or yeast expression systems. For laboratory-scale research, E. coli expression systems are frequently preferred due to their rapid growth, high protein yields, and well-established protocols. The protein is typically expressed with a His-tag to facilitate purification . For studies requiring post-translational modifications or when solubility issues are encountered in E. coli, yeast expression systems may be utilized .

What are the typical storage conditions for recombinant lplC protein?

Recombinant lplC protein should be stored according to the following guidelines:

  • Short-term storage: +4°C

  • Long-term storage: -20°C to -80°C

  • Storage buffer: PBS (Phosphate Buffered Saline)

The protein may be supplied in either liquid form or as a lyophilized powder, depending on the manufacturer or laboratory preparation protocols .

What are the main challenges in expressing functional lplC in heterologous systems?

Expression of functional lplC protein faces several challenges:

  • Membrane protein expression barriers: As an ABC transporter permease, lplC is a membrane protein that often encounters folding issues when expressed in heterologous systems. This can lead to inclusion body formation or misfolded proteins .

  • Secretion bottlenecks: When using B. subtilis as an expression host, secretion bottlenecks can occur at various levels including membrane targeting, translocation, and post-translocational protein folding .

  • Proteolytic degradation: B. subtilis naturally secretes multiple proteases that can degrade heterologous proteins. While protease-deficient strains exist, this problem has not been completely eliminated .

  • Codon usage bias: Differences in codon preferences between the native B. subtilis and the expression host can significantly impact translation efficiency and protein yield .

How can genome editing techniques be applied to optimize lplC expression in B. subtilis?

Recent advances in B. subtilis genome editing can be applied to optimize lplC expression:

  • ssDNA-mediated genome editing: A method using single-stranded PCR products with short homology regions (approximately 70 nt) can be employed to make targeted modifications to the lplC gene or its regulatory elements. This technique uses the lambda beta protein for homologous recombination and the Cre recombinase for marker removal .

  • Multiplex genome editing: Multiple genomic modifications can be made simultaneously in B. subtilis by transforming several PCR products into cells harboring the temperature-sensitive plasmid pWY121. This approach allows for complex strain engineering without leaving markers in the genome .

  • Promoter engineering: The native promoter controlling lplC expression can be replaced with stronger or inducible promoters to enhance protein production. Fine-tuning of gene expression can be achieved through promoter regulation and engineering .

What is the recommended protocol for preparing B. subtilis samples for lplC protein analysis via SDS-PAGE?

B. subtilis Sample Preparation for SDS-PAGE Analysis:

  • Culture B. subtilis strains in LB medium until mid-log growth phase (OD600 of 0.8-1.0).

  • Collect aliquots equivalent to an OD600 of 2.4 in a 1.5-ml tube.

  • Centrifuge at 13,000 g for 5 minutes to pellet cells.

  • Resuspend the collected cells in lysis buffer containing lysozyme.

  • Mix with sample loading buffer.

  • Centrifuge the mixture.

  • Load an appropriate volume of supernatant into each well of a polyacrylamide gel.

  • Perform electrophoresis following standard protocols.

  • Stain, destain, and analyze the gel using densitometry software .

This protocol is effective for analyzing cytoplasmic expression of recombinant proteins in B. subtilis and can be adapted for membrane proteins like lplC with appropriate modifications to the lysis buffer .

How can secretion of recombinant lplC be improved in B. subtilis expression systems?

Improving lplC secretion in B. subtilis can be achieved through several strategies:

StrategyMechanismAdvantagesLimitations
Signal peptide optimizationEnhances protein targeting to secretion machineryCan be tailored to specific proteinsRequires empirical testing of multiple signal peptides
SecDF overexpressionImproves protein translocation efficiencyAddresses a key bottleneck in secretionMay create imbalance in secretion pathway components
Protease-deficient strainsReduces proteolytic degradationPreserves integrity of secreted proteinsMay affect cell growth and physiology
Genome minimizationRemoves competing pathways and unnecessary genesStreamlines cellular resources for target proteinComplex engineering process

What purification strategies are most effective for His-tagged recombinant lplC protein?

Purification of His-tagged recombinant lplC typically involves the following steps:

  • Cell lysis optimization: As lplC is a membrane protein, effective cell disruption is crucial. This can be achieved using sonication, French press, or detergent-based lysis buffers containing appropriate detergents like n-dodecyl β-D-maltoside (DDM) or Triton X-100 to solubilize the membrane fraction.

  • Immobilized metal affinity chromatography (IMAC): The His-tagged lplC protein can be purified using Ni-NTA or Co-NTA resin columns. The binding buffer typically contains 20-50 mM imidazole to reduce non-specific binding, while elution is performed with 250-500 mM imidazole .

  • Size exclusion chromatography (SEC): This step helps separate aggregated protein from properly folded lplC and removes remaining impurities. It also allows for buffer exchange to remove imidazole.

  • Quality control assessment: Purified lplC protein should be assessed for purity (>80% by SDS-PAGE), endotoxin levels (<1.0 EU per μg), and functionality through appropriate activity assays .

How can researchers verify the structural integrity and functionality of purified recombinant lplC?

Verification of structural integrity and functionality of purified lplC can be performed using multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy: To assess secondary structure content and proper folding.

  • Thermal shift assays: To evaluate protein stability and the effects of various buffer conditions.

  • Limited proteolysis: To examine the accessibility of protease cleavage sites as an indicator of proper folding.

  • ATP binding/hydrolysis assays: Since lplC is part of an ABC transporter system, ATP interaction studies can provide insights into functional integrity.

  • Reconstitution into liposomes or nanodiscs: To test transport activity in a membrane-mimicking environment.

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST): To characterize interactions with potential transport substrates or other components of the ABC transporter complex.

How is recombinant lplC protein being used in structural biology studies?

Recombinant lplC protein serves as a valuable model for structural studies of bacterial ABC transporters. Key applications include:

  • Crystallography and cryo-EM analysis: Purified, stable lplC protein can be used for structural determination through X-ray crystallography or cryo-electron microscopy. These techniques provide atomic-level insights into the permease structure, which is essential for understanding transport mechanisms.

  • Structure-function relationship studies: By combining structural data with site-directed mutagenesis, researchers can identify key residues involved in substrate recognition, translocation pathway formation, and interactions with other ABC transporter components .

  • Membrane protein structural biology method development: As a relatively well-expressed bacterial membrane protein, lplC can serve as a test case for developing improved methods for membrane protein solubilization, stabilization, and crystallization.

What are the latest approaches for optimizing fermentation conditions for maximal lplC expression?

Optimization of fermentation conditions for maximal lplC expression involves several key strategies:

  • Medium optimization: Specific nutrient requirements can significantly impact lplC expression. Systematic testing of different carbon sources, nitrogen sources, and trace elements can identify optimal medium compositions.

  • Process condition optimization: Parameters such as temperature, pH, dissolved oxygen, and agitation speed must be carefully controlled. For lplC expression, lower temperatures (25-30°C) may be beneficial to reduce inclusion body formation due to its membrane protein nature .

  • Feeding strategy optimization: For high cell density cultures, fed-batch processes with optimized feeding strategies can significantly increase yields. Carbon source feeding rates should be adjusted to prevent overflow metabolism while maintaining high expression rates .

  • Induction optimization: If using inducible promoters, the timing, concentration, and method of inducer addition significantly impact production. For membrane proteins like lplC, gradual induction may be preferable to prevent overwhelming the membrane insertion machinery .

Fermentation ParameterImpact on lplC ExpressionOptimization Strategy
TemperatureAffects protein folding and membrane integrationLower temperatures (25-30°C) often improve membrane protein folding
Inducer concentrationDetermines expression level and potential toxicityGradual induction or reduced inducer levels to prevent membrane stress
Dissolved oxygenInfluences cellular metabolism and energy availabilityMaintain at 30-50% saturation for balanced growth and expression
pHAffects protein stability and cellular physiologyControl between 6.8-7.2 for optimal expression
Carbon sourceProvides energy for protein synthesisGlucose or glycerol with controlled feeding to prevent overflow metabolism

What strategies can address poor yield or insolubility of recombinant lplC protein?

Poor yield or insolubility of lplC protein can be addressed through several approaches:

  • Codon optimization: Adapting the lplC gene sequence to match the codon preference of the expression host can significantly improve translation efficiency and protein yield .

  • Expression temperature reduction: Lowering the culture temperature after induction to 16-25°C can slow down protein synthesis, allowing more time for proper folding and membrane integration.

  • Co-expression with chaperones: Molecular chaperones like GroEL/ES in E. coli or PrsA in B. subtilis can assist in proper protein folding. Fine-tuning gene expression based on proteases and molecular chaperones has been shown to improve yield and solubility .

  • Alternative detergents for membrane protein extraction: Testing a panel of detergents with varying properties can identify optimal conditions for lplC solubilization without denaturation.

  • Fusion partners: N- or C-terminal fusion with solubility-enhancing partners such as MBP (maltose-binding protein) or SUMO (small ubiquitin-like modifier) can improve expression and solubility.

How can researchers address issues with proteolytic degradation of lplC during expression and purification?

Proteolytic degradation of lplC can be mitigated through several strategies:

  • Protease-deficient expression strains: Utilizing B. subtilis strains lacking multiple proteases or E. coli strains like BL21(DE3) pLysS that are deficient in key proteases .

  • Protease inhibitors: Including a comprehensive protease inhibitor cocktail in all buffers during cell lysis and initial purification steps.

  • Optimized purification workflow: Minimizing processing time and maintaining samples at 4°C throughout the purification process to reduce the window for proteolytic activity.

  • Buffer optimization: Testing different pH values and salt concentrations to identify conditions that minimize proteolytic activity while maintaining lplC stability.

  • Genetic modifications: If specific proteolytic cleavage sites are identified within lplC, site-directed mutagenesis can be employed to remove these sites without affecting protein function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.