Recombinant Bacillus subtilis Protein mistic (mstX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
mstX; BSU31321; BSU31320; Protein mistic; Membrane-integrating protein MstX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
mstX
Target Protein Sequence
MFCTFFEKHHRKWDILLEKSTGVMEAMKVTSEEKEQLSTAIDRMNEGLDAFIQLYNESEI DEPLIQLDDDTAELMKQARDMYGQEKLNEKLNTIIKQILSISVSEEGEKE
Uniprot No.

Target Background

Function
Mistic (mstX) is a chaperone protein that facilitates the production and integration of integral membrane proteins into the bacterial lipid bilayer.
Gene References Into Functions
  1. When purified, detergent-solubilized EnvZ receptor is fused to Mistic, it retains its ability for autophosphorylation at Histidine 243 and subsequent phosphotransfer to Aspartate 55 on OmpR. PMID: 20849081
Database Links

KEGG: bsu:BSU31321

Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Folds autonomously into the membrane, bypassing the cellular translocon machinery.

Q&A

What is Mistic and what makes it unique among membrane proteins?

Mistic (Membrane Integrating Sequence for Translation of Integral Membrane Protein Constructs) is a recently identified protein in Bacillus subtilis that facilitates the expression and targeting of integral membrane proteins . Unlike typical membrane proteins, Mistic can autonomously fold into the lipid bilayer without requiring the cellular translocon machinery . This 110-amino acid protein forms a four-helical bundle with a surprisingly polar lipid-facing surface, as determined by NMR spectroscopy . Bioinformatic analysis has expanded the number of Mistic homologs from 4 to 20, including proteins outside the genus Bacillus .

What cellular functions does Mistic perform in Bacillus subtilis?

Mistic serves as a novel regulator of biofilm formation in B. subtilis, functioning in concert with YugO, a putative potassium channel . The mstX gene is under the regulation of SinR, the master regulator for biofilm formation . Mistic and YugO functionality depends on extracellular potassium levels and involves a potassium-sensing histidine kinase . The protein participates in a positive autoregulatory loop involving KinC, influencing the activity of Spo0A, which is critical for bacterial development and biofilm formation . This regulatory pathway expands our understanding of potassium homeostasis in bacterial developmental processes.

How is the mstX-yugO operon organized and regulated?

The mstX gene is part of the mstX-yugO operon, which contains a highly conserved Shine-Dalgarno sequence important for downstream translation of the potassium ion channel yugO . Transcription of this operon is under negative regulation by SinR, which controls the switch between planktonic and sessile states in B. subtilis . Additionally, environmental factors, particularly extracellular potassium levels, affect the functionality of the MstX-YugO system, providing an additional layer of regulation . This complex regulatory network ensures appropriate expression of mstX and yugO in response to environmental conditions.

How do Mistic homologs differ in their solution behavior and membrane association?

Shorter Mistic homologs from other Bacillus species exhibit significant differences compared to the original B. subtilis Mistic (M110):

  • Unlike M110, these homologs are found abundantly in the cytoplasm .

  • They exist as multimeric, α-helical oligomers in solution when purified without detergent .

  • Crystallographic studies of Mistic from B. leicheniformis (M2) demonstrate multimer formation in crystalline arrays .

  • Despite being predominantly α-helical, M2 tends to polymerize and form fibrils .

These differences suggest that various Mistic homologs have evolved distinct mechanisms for membrane association and function, potentially explaining their diverse roles across Bacillus species.

What explains Mistic's unusual membrane integration despite its hydrophilic character?

The paradoxical membrane integration of Mistic despite its hydrophilic surface appears to be related to its oligomerization properties. Research indicates that:

  • Oligomerization may mask the charged surface of monomeric Mistic, facilitating membrane integration .

  • Individual helical fragments show different membrane association properties - three of the four helices interact with membranes in vivo and in vitro, while the third helical fragment interacts only with LDAO micelles but not lipid bilayers .

  • Mutations that disrupt membrane-chaperoning properties also abrogate polymerization and fibril formation, suggesting a functional link between these phenomena .

This mechanism represents a novel pathway for membrane protein integration that bypasses the traditional Sec translocon machinery.

What experimental methods are most effective for studying Mistic's structure and dynamics?

Several complementary approaches have proven valuable for investigating Mistic:

MethodApplicationKey Insights
Solution NMR spectroscopyStructural determinationRevealed the four-helical bundle structure in detergent micelles (LDAO, DPC)
Circular dichroism spectroscopySecondary structure analysisCharacterized helical content of Mistic fragments in various lipids and detergents
GFP fusion studiesCellular localizationDetermined membrane association properties of individual helical fragments in vivo
X-ray crystallographyMultimeric structureDemonstrated crystalline multimer formation of M2 homolog at 3.2 Å resolution
Solid-phase peptide synthesisHelical fragment analysisEnabled study of individual helices' interactions with various membrane environments

Combined use of these methods provides comprehensive insights into Mistic's structural features and membrane interaction mechanisms.

How does Mistic enhance the expression of other membrane proteins?

Mistic serves as an effective fusion partner for enhancing membrane protein expression through several mechanisms:

  • It autonomously targets fused proteins to the membrane, bypassing the canonical secretory apparatus that can be a bottleneck for heterologous expression .

  • This autonomous membrane integration prevents overloading of the bacterial targeting machinery that cells typically use to insert membrane proteins .

  • Mistic appears to assist in proper folding and membrane integration of partner proteins, potentially through its unique membrane interaction properties .

  • When used as an N-terminal fusion tag, it facilitates the production of prokaryotic and eukaryotic membrane proteins that are otherwise difficult to express in bacterial systems .

This capability has made Mistic a valuable tool for structural and functional studies of membrane proteins that have traditionally been challenging to produce in sufficient quantities.

For optimal results when using Mistic as an expression tag, researchers should consider:

  • Fusion design options:

    • Full-length Mistic can be used, but individual helical fragments (particularly helices 1, 2, and 4) can replace full-length Mistic with different effects on quantity and quality of expressed protein .

    • Including appropriate linker sequences between Mistic and the target protein may improve folding and function.

  • Expression conditions:

    • Lower temperatures (16-25°C) often yield better results for membrane protein expression.

    • Milder induction conditions using reduced concentrations of inducers may prevent aggregation.

    • Rich media supplemented with appropriate antibiotics typically support optimal expression.

  • Purification strategies:

    • LDAO has proven effective for extracting and purifying Mistic-fusion proteins .

    • Consider including a cleavable linker to remove the Mistic tag after membrane integration if required for downstream applications.

  • Host selection:

    • While E. coli is most commonly used, Mistic fusions have shown success in other bacterial expression systems .

    • B. subtilis itself can be used as an expression host, leveraging its GRAS status and natural ability to secrete proteins .

These strategies should be optimized for each specific target protein to maximize expression and functionality.

How does Mistic's polymerization and fibril formation relate to its biological function?

The tendency of Mistic homologs to polymerize and form fibrils appears functionally significant:

  • Mistic homologs form multimeric, α-helical oligomers in solution when purified without detergent .

  • The M2 homolog forms multimers in a crystalline array and can further polymerize into fibrils .

  • Mutations that disrupt membrane-chaperoning properties also prevent polymerization and fibril formation, suggesting these processes are mechanistically linked .

  • Oligomerization may mask charged surfaces of monomeric Mistic, potentially explaining how this predominantly hydrophilic protein can associate with membranes .

These findings suggest that Mistic's unusual aggregation properties may be integral to its native function in biofilm formation, possibly by facilitating protein-protein interactions or creating structural scaffolds in the developing biofilm matrix.

What is the mechanistic relationship between Mistic, potassium homeostasis, and biofilm formation?

Mistic regulates biofilm formation through a potassium-dependent pathway:

  • Mistic and YugO (a putative potassium channel) work together to regulate potassium flux across the membrane .

  • This potassium flux appears to activate KinC, a histidine kinase sensitive to membrane potential changes .

  • Activated KinC phosphorylates Spo0A, the master regulator of bacterial development .

  • Phosphorylated Spo0A initiates the transcriptional program required for biofilm formation .

  • Addition of exogenous potassium abrogates Mistic-mediated biofilm formation, confirming the importance of potassium gradient in this signaling pathway .

This mechanism reveals a novel intersection between ion homeostasis, membrane potential, and developmental signaling in bacteria, potentially representing a broader paradigm for how bacteria sense and respond to their environment.

How might the native function of Mistic inform its biotechnological applications?

Understanding Mistic's native biology offers insights for optimizing its biotechnological applications:

  • Structure-function relationships: Knowledge of which helical domains are critical for membrane integration can inform the design of optimized Mistic fusion constructs .

  • Oligomerization properties: Understanding the conditions that promote or prevent Mistic aggregation could help develop expression strategies that maximize functional protein yield .

  • Potassium sensitivity: Considering the role of potassium in Mistic's native function, manipulating potassium levels in expression media might influence the behavior of Mistic fusion proteins .

  • Regulatory elements: The conserved Shine-Dalgarno sequence in the mstX-yugO operon might be exploited to enhance translation efficiency in expression systems .

These insights demonstrate how fundamental research into Mistic's biology has direct applications for biotechnology, highlighting the value of basic science for applied research.

What are the critical unanswered questions about Mistic's structure and function?

Despite significant progress, several fundamental questions remain:

  • What is the precise mechanism by which Mistic autonomously integrates into membranes without the Sec translocon?

  • How does Mistic's oligomerization state relate to its membrane topology and orientation?

  • What is the structural basis for Mistic's interaction with and regulation of the YugO potassium channel?

  • Do post-translational modifications play a role in regulating Mistic function?

  • How widespread is the mstX-yugO system across bacterial species, and does it serve similar functions in diverse organisms?

Addressing these questions will require integrating structural biology, membrane biophysics, and bacterial genetics approaches.

How might advances in membrane protein science enhance Mistic-based technologies?

Emerging approaches in membrane protein science could further enhance Mistic-based expression systems:

  • Nanodiscs and membrane mimetics: New membrane mimetics might provide better environments for studying Mistic-fusion proteins while maintaining native-like conditions.

  • Cryo-electron microscopy: This rapidly advancing technique could resolve high-resolution structures of Mistic-fusion proteins in membrane environments.

  • Advanced computational methods: Molecular dynamics simulations could predict optimal fusion designs and membrane integration strategies for specific target proteins.

  • Synthetic biology approaches: Engineering modified Mistic variants with enhanced properties for specific expression applications could expand its utility.

  • Integration with MISTIC2 computational tools: The MISTIC2 server for studying protein coevolution could provide insights into critical residues for Mistic function and interaction with fusion partners .

These interdisciplinary approaches promise to expand both our fundamental understanding of Mistic and its practical applications in biotechnology.

What potential exists for engineering modified Mistic variants with enhanced properties?

The potential for engineering enhanced Mistic variants is substantial:

  • Stability engineering: Creating Mistic variants with increased thermostability or resistance to aggregation could improve expression yields.

  • Specificity engineering: Developing Mistic variants optimized for particular membrane environments or fusion partners could expand its application range.

  • Functional modifications: Engineering Mistic to include reporting functions (e.g., fluorescence or enzymatic activity) could create bifunctional tools for membrane protein studies.

  • Minimal functional domains: Identifying the smallest Mistic fragment that retains membrane integration properties could lead to more efficient expression tags.

  • Cross-species optimization: Tailoring Mistic variants for optimal function in diverse expression hosts beyond E. coli could broaden its utility.

Such engineering efforts would benefit from the expanding knowledge of Mistic homologs across bacterial species and the structural insights gained from biophysical studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.