Recombinant Bacillus subtilis Protein natB (natB)

Shipped with Ice Packs
In Stock

Description

Secretion Systems

B. subtilis employs two primary secretion pathways:

PathwayMechanismKey Applications
Sec-dependentUtilizes ATP-driven translocation via membrane channels (e.g., SecA/Y/E/G)Secretion of extracellular enzymes, vaccines
Tat-dependentTransports folded proteins using twin-arginine motifsExport of bioactive peptides, nanobodies

These systems enable proper folding and extracellular release of recombinant proteins, leveraging native signal peptides for targeting .

Promoter Systems

Diverse promoter strategies enhance expression efficiency:

Promoter TypeFunctionExample Use Cases
ConstitutiveContinuous expression without inductionHigh-yield production of stable proteins
InducibleControlled by chemicals (e.g., IPTG) or riboswitchesTightly regulated expression of toxic proteins
Self-inducingAuto-regulated expression via metabolite sensingCost-effective industrial production

Recent advancements include pgrac-based inducer-free vectors and synthetic promoters tailored for stress resistance .

Case Studies in Recombinant Protein Production

Surface Display on Spores

B. subtilis spores can be engineered to display recombinant proteins on their coat. For example:

ProteinFusion PartnerYieldApplication
Tetanus Toxin FragmentCotB (spore coat)>1.5 × 10³ molecules/sporeVaccine development

This system leverages spore stability under extreme conditions (heat, desiccation) for vaccine delivery .

Genome-Reduced Strains

Genome streamlining enhances productivity:

StrainModificationsPerformance Metrics
IIG-Bs-27-39Deletion of sporulation, proteases, flagellaIsaA secretion: 15–20 mg/L
NADPH pools: +30% vs. wild-type

This strain shows improved growth rates and metabolic efficiency, with elevated NADPH levels supporting anabolic processes .

Challenges and Future Directions

  • Secretion Bottlenecks: Overexpression of complex proteins (e.g., multi-subunit enzymes) remains a challenge, requiring optimization of signal peptides and folding chaperones .

  • Metabolic Engineering: Targeting NADPH/NADH pools and ATP yields could further enhance productivity .

  • Genetic Code Expansion: Incorporation of non-standard amino acids (e.g., click chemistry tags) enables precise protein functionalization .

References Multifunctionality of B. subtilis expression systems (PMC8649419) Spore-based surface display (Journal of Bacteriology) Biotechnological applications of spores (PMC7440806) Genetic code expansion (Nature Communications) Genome-reduced strain IIG-Bs-27-39 (ACS Synthetic Biology) Review of expression strategies (SAGE Journals)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
natB; BSU02760; ABC transporter permease protein NatB; ABC-type Na(+ transporter
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
natB
Target Protein Sequence
MLSHIYKKEMIDALRDRKTILLTILVPMIMMLGLVFFYESMLSDKGEQYTLAVGHSLPPA LESKLNEIDEISVKTFAKPEEAVDEGKADAYLNVPKEFDSYVNSMTPFKVDVYGNSIDQG SSNAMQLVQSALDQYKNEIVQQRLTNKHIDQSVIQPFTIQQKEADEEKGTSAIMLSAILP MLILTSIVSGAMPIALDIMAGEKDRKSIEALLLTPVSRNKVLVGKWLAVSTFGVASGVFA LVFLILSTVLFTENLKTAFQLGDHMWSVIGASALIIVLSALLISAMELFISIMSSSVKEA QSYMSLVVFLPVFPMFFIFSKAPNQFDLSYFLIPFLNLHALFKQLLFGMVDPATILSTSG TIAVLIAIFFLLARACFLKDKWVLPK
Uniprot No.

Target Background

Function
natB is a component of an ABC transporter responsible for catalyzing ATP-dependent electrogenic sodium extrusion.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What makes Bacillus subtilis an ideal expression system for recombinant proteins like natB?

Bacillus subtilis offers multiple advantages as an expression host for recombinant proteins such as natB. Its GRAS (Generally Recognized As Safe) status makes it suitable for producing therapeutic proteins without endotoxin contamination concerns. The bacterium possesses a remarkable innate ability to absorb and incorporate exogenous DNA into its genome, facilitating genetic manipulation for natB expression. Additionally, B. subtilis features a well-developed secretion system that can efficiently transport proteins across the cell membrane, simplifying downstream purification processes. These characteristics, combined with decades of accumulated scientific knowledge regarding its biology, have enabled the development of sophisticated genetic engineering strategies for recombinant protein expression .

Research data indicates that B. subtilis can achieve expression levels of specific recombinant proteins up to 16% of total cellular proteins in the cytoplasm, with some proteases reaching specific activities of 8065 U/mg, demonstrating its capacity for high-yield protein production .

What promoter systems are most effective for natB expression in B. subtilis?

For natB expression, both constitutive and inducible promoter systems have proven effective in B. subtilis. The P_grac212 promoter has demonstrated robust expression capabilities, making it particularly suitable for natB production. Chemical inducers for B. subtilis expression systems include IPTG and various carbohydrates such as sucrose, mannose, xylose, maltose, and starch .

How does the germination and outgrowth cycle of B. subtilis affect recombinant natB production?

The germination and outgrowth cycle significantly impacts recombinant natB production timing and yield. Proteome analysis of B. subtilis during germination and outgrowth has identified distinct protein expression kinetics across 14 time points from 0 to 130 minutes post-germination. Four different expression clusters were identified, each with specific functional categories and KEGG pathway annotations .

The most significant changes in newly synthesized proteins occur within the first 50 minutes of germination. Understanding these temporal dynamics is crucial when designing natB expression systems, as the timing of induction and harvesting can substantially affect protein yield and quality. For optimal natB production, expression induction may be strategically timed to coincide with specific phases of the germination and outgrowth cycle .

How can amber suppression systems be optimized for incorporating non-canonical amino acids into natB?

Amber suppression technology enables the site-specific incorporation of non-canonical amino acids (ncAAs) into proteins like natB, expanding their functionality for research applications. An efficient IPTG-inducible amber suppression system has been developed for B. subtilis that enables expression, secretion, and direct purification of target proteins carrying ncAAs .

When applying this methodology to natB:

  • Design an expression construct containing the natB gene with a strategically placed amber (TAG) codon at the desired incorporation site

  • Co-express the orthogonal aminoacyl-tRNA synthetase/tRNA pair specific for the desired ncAA

  • Supplement the growth medium with the ncAA (typically 1-5 mM)

  • Induce expression with IPTG (0.1-1.0 mM)

Using this approach, researchers have achieved yields of approximately 2 mg/L for other recombinant proteins. This system creates opportunities for producing natB variants containing bio-orthogonal groups that can undergo selective chemical modifications, expanding the protein's research and biotechnological applications .

What strategies effectively address protease degradation of natB during expression?

Protease degradation represents a significant challenge in recombinant protein expression, including natB production in B. subtilis. Several effective strategies can mitigate this issue:

  • Genetic manipulation of host strains: Creating protease-deficient B. subtilis strains by knocking out genes encoding major extracellular proteases (WprA, NprB, AprE, Epr, Bpr, NprE, Mpr)

  • Expression timing optimization: Coordinating expression phases with naturally occurring protease expression cycles based on proteome analysis data

  • Co-expression of protease inhibitors: Introducing genes encoding specific protease inhibitors alongside the natB gene

  • Signal peptide engineering: Modifying secretion signal peptides to improve translocation efficiency and reduce exposure to cytoplasmic proteases

Research has demonstrated that the HRV3C protease expressed in B. subtilis can achieve specific activities of 8065 U/mg when optimized using these approaches, suggesting similar strategies could benefit natB production .

How can transcription factor activities be leveraged to enhance natB expression in B. subtilis?

B. subtilis contains approximately 215 transcription factors (TFs) regulating over 4,516 interactions within its global regulatory network. Utilizing network component analysis (NCA) and model selection techniques, researchers can identify key TFs influencing natB expression and strategically modify their activities .

To leverage this regulatory network for enhanced natB expression:

  • Analyze transcriptomics data from multiple experimental conditions (>30 distinct conditions) to identify TFs that influence natB expression

  • Implement modifications to enhance activity of positively regulating TFs or suppress negatively regulating TFs

  • Engineer promoter regions to incorporate or remove binding sites for specific TFs

  • Consider the temporal dynamics of TF activities, particularly during stress responses or developmental transitions

Understanding these regulatory networks has enabled researchers to improve expression by up to 74% for some recombinant proteins, and similar approaches could be applied to optimize natB expression .

What is the optimal protocol for purifying recombinant natB from B. subtilis culture?

For efficient purification of recombinant natB from B. subtilis culture, the following optimized protocol is recommended:

  • Culture harvesting: Collect cells by centrifugation (6,000 × g, 15 min, 4°C)

  • Protein extraction options:

    • For secreted natB: Directly collect supernatant

    • For intracellular natB: Perform cell lysis via sonication or lysozyme treatment

  • Initial clarification: Centrifuge at 12,000 × g for 30 minutes at 4°C

  • Affinity chromatography: Apply to appropriate affinity matrix based on fusion tag:

    • His-tagged natB: Ni-NTA resin

    • Cellulose-binding domain fusion: Cellulose matrix

  • Elution conditions:

    • His-tagged: 250 mM imidazole buffer

    • Cellulose-binding: 1% cellobiose or high-pH buffer

  • Secondary purification: Size exclusion chromatography to eliminate aggregates

  • Concentration and buffer exchange: Using appropriate molecular weight cutoff membranes

This method has been successfully applied to nanobodies expressed in B. subtilis with high purity yields and can be adapted for natB purification .

How can spore-based storage systems be utilized for long-term preservation of natB-expressing B. subtilis strains?

B. subtilis spores offer exceptional stability for long-term preservation of strains engineered to express natB. These spores demonstrate high resistance to environmental stressors including heat, acidic pH, and desiccation, while maintaining the genetic integrity of the expression system .

To establish a spore-based storage system for natB-expressing strains:

  • Sporulation induction: Culture cells on DSM (Difco Sporulation Medium) for 24-48 hours until >90% sporulation is achieved

  • Spore harvesting: Collect spores by centrifugation and wash 3-5 times with sterile cold water

  • Purification: Remove vegetative cells using lysozyme treatment or heat shock (80°C, 20 min)

  • Storage options:

    • Lyophilized state: Store at room temperature in sealed containers with desiccant

    • Liquid suspension: Store at 4°C in sterile water or at -80°C in 25% glycerol

  • Revival protocol: Rehydrate spores in rich medium and incubate at 37°C for 60-90 minutes to initiate germination

Research has demonstrated that even after prolonged storage in desiccated conditions, B. subtilis spores maintain their ability to germinate, outgrow, and express recombinant proteins without reduction in yield or quality. This approach provides a convenient, robust system for maintaining natB expression strains without continuous subculturing .

What experimental design effectively measures the impact of different signal peptides on natB secretion efficiency?

To systematically evaluate how different signal peptides affect natB secretion efficiency, researchers should implement the following experimental design:

  • Signal peptide selection:

    • Native B. subtilis signal peptides (AmyE, AprE, BprE, Vpr)

    • Heterologous signal peptides from other Gram-positive bacteria

    • Synthetic or hybrid signal peptides with optimized features

  • Expression construct preparation:

    Signal PeptideOriginCharacteristicsExpected Efficiency
    SP_AmyEB. subtilis α-amylaseHigh secretion capacityHigh
    SP_AprEB. subtilis alkaline proteaseWell-characterizedMedium-High
    SP_PelBE. coliCommonly used in heterologous systemsVariable
    SP_YncMB. subtilisLess common but selectiveMedium
  • Quantification methods:

    • Western blotting of culture supernatants and cell lysates

    • Enzyme-linked immunosorbent assay (ELISA)

    • Activity assays (if natB has measurable activity)

    • Mass spectrometry to detect signal peptide processing

  • Calculation of secretion efficiency:

    • Ratio of extracellular to total protein

    • Secretion rate during exponential growth phase

    • Signal peptide processing completeness

This approach has enabled researchers to improve secretion efficiency by up to 11-16% of total cellular protein for certain recombinant constructs and can be adapted to optimize natB secretion .

How can researchers address incorrect protein folding when expressing natB in B. subtilis?

Incorrect protein folding represents a common challenge when expressing recombinant proteins like natB. To address this issue:

  • Co-expression of chaperones: Introduce molecular chaperones such as GroEL/GroES or DnaK/DnaJ/GrpE systems to assist proper folding

  • Temperature optimization: Lower cultivation temperature (25-30°C instead of 37°C) to slow translation rate and allow more time for proper folding

  • Induction optimization: Use lower inducer concentrations for slower, more controlled expression

  • Fusion partners: Incorporate solubility-enhancing fusion tags such as thioredoxin (Trx) or maltose-binding protein (MBP)

  • Disulfide bond formation: For natB variants containing disulfide bonds, co-express disulfide isomerases or use oxidizing extracellular environment

The combination of these approaches has been demonstrated to improve correct folding efficiency for various recombinant proteins in B. subtilis, with fusion proteins showing up to 15% higher solubility compared to non-fusion variants .

What strategies resolve expression bottlenecks identified through transcriptional and proteomic analyses?

Addressing expression bottlenecks requires integrated analysis of transcriptional and proteomic data. Based on comprehensive B. subtilis proteome studies, several strategies can resolve common bottlenecks in natB expression:

  • Transcription bottlenecks:

    • Promoter optimization based on global transcriptional regulatory network data

    • Implementation of dual promoter systems for enhanced transcription

    • Modification of transcription factor binding sites identified through network component analysis

  • Translation bottlenecks:

    • Codon optimization based on B. subtilis preferred codon usage

    • Optimization of ribosome binding sites for improved translation initiation

    • Strategic placement of rare codons to control translation rate at critical folding junctures

  • Post-translational bottlenecks:

    • Engineering of signal peptides for improved secretion

    • Co-expression of specific chaperones identified through proteomic analysis

    • Removal of potential proteolytic cleavage sites

Analysis of the B. subtilis proteome during germination and outgrowth has identified distinct protein expression patterns across different time points, which can inform the timing of induction and harvest to maximize yield .

How can researchers validate the biological activity of recombinant natB expressed in B. subtilis compared to native sources?

Validating the biological activity of recombinant natB requires comprehensive comparative analysis with native protein:

  • Structural analysis:

    • Circular dichroism (CD) spectroscopy to compare secondary structure profiles

    • Differential scanning calorimetry (DSC) to assess thermal stability

    • Nuclear magnetic resonance (NMR) or X-ray crystallography for detailed structural comparison

  • Functional assays:

    • Enzyme kinetics (if natB has enzymatic activity)

    • Binding affinity measurements using surface plasmon resonance (SPR)

    • Cell-based functional assays relevant to natB's biological role

  • Post-translational modification analysis:

    • Mass spectrometry to identify and compare modifications

    • Glycosylation analysis (if applicable)

    • Phosphorylation state comparison

  • Stability assessment:

    • Accelerated stability studies under various conditions

    • Aggregation propensity using dynamic light scattering

    • Resistance to proteolytic degradation

This multi-faceted approach provides comprehensive validation of recombinant natB's structural and functional equivalence to the native protein, ensuring its suitability for downstream research applications .

How can recombinant natB be incorporated into stable spore-based delivery systems?

Recombinant natB can be effectively incorporated into spore-based delivery systems using several established approaches:

  • Spore surface display:

    • Genetic fusion of natB to spore coat proteins (CotB, CotC, CotG)

    • Expression during sporulation for incorporation into the developing spore coat

    • Verified retention of protein functionality through appropriate activity assays

  • Germination-triggered expression:

    • Engineering spores to express natB upon germination using germination-specific promoters

    • Utilizing the natural resistance properties of spores for prolonged storage

    • Controlling protein release through germination conditions

  • Encapsulation approaches:

    • Microencapsulation of purified natB with spores in protective matrices

    • Layered assembly of spores and natB for sequential release

    • Protection of natB activity during storage using spore-derived stabilizing factors

Research has demonstrated that B. subtilis spores maintain their ability to germinate and express recombinant proteins even after exposure to harsh environmental conditions, making them ideal vehicles for natB delivery in various applications .

What approaches enable site-specific modifications of natB using the B. subtilis expression system?

Site-specific modifications of natB can be achieved through several advanced approaches:

  • Amber suppression technology:

    • Introduction of TAG codons at targeted positions in the natB gene

    • Co-expression of orthogonal aminoacyl-tRNA synthetase/tRNA pairs

    • Incorporation of non-canonical amino acids with reactive functional groups

    • Achieved yields of approximately 2 mg/L for similar recombinant proteins

  • Enzymatic modifications:

    • Co-expression of site-specific modification enzymes (kinases, glycosyltransferases)

    • Engineering of recognition sequences at desired modification sites

    • Temporal control of modification by using inducible promoters for both natB and modifying enzymes

  • Split-intein mediated approaches:

    • Fusion of split-intein fragments to natB and the desired modification

    • Precise splicing to incorporate modifications at specific locations

    • Purification of the resulting modified protein through appropriate affinity tags

These approaches have enabled researchers to produce proteins containing bio-orthogonal groups that can undergo selective chemical modifications, expanding the range of potential natB applications in research and biotechnology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.