Recombinant Bacillus subtilis Putative ABC transporter permease protein AmyC (amyC)

Shipped with Ice Packs
In Stock

Description

Protein Overview

AmyC (UniProt ID: O34518) is a 276-amino-acid protein encoded by the amyC gene in B. subtilis. Recombinant versions are typically expressed in Escherichia coli with an N-terminal His-tag for purification . Key specifications include:

ParameterDetail
Source OrganismBacillus subtilis (strain 168)
Expression SystemE. coli
TagN-terminal His-tag
Molecular Weight~32 kDa (calculated)
Purity>85% (SDS-PAGE)
StorageLyophilized or liquid form at -20°C/-80°C; avoid repeated freeze-thaw

Functional Roles

ABC transporters in B. subtilis are multifunctional:

  • Antibiotic Resistance: Transporters such as BceAB and BmrCD export bacitracin, erythromycin, and other antibiotics .

  • Cell Wall Biosynthesis: Systems like YtrBCDEF influence cell wall thickness and competence development .

  • Nutrient Uptake: Oligopeptide permeases (e.g., Opp) import peptides for metabolism and signaling .

AmyC’s exact substrate remains unconfirmed, but its classification as a permease suggests involvement in exporting small molecules or peptides, potentially linked to stress responses .

Expression and Purification

  • Recombinant AmyC is produced in E. coli with yields optimized via codon adaptation and affinity chromatography .

  • Stability assays recommend storage in 50% glycerol at -80°C to retain activity .

Genetic Context

  • The amyC gene is distinct from amyQ (encoding α-amylase), which is overexpressed in high-yield B. subtilis strains for industrial enzyme production .

Antibiotic Resistance Link

  • ABC transporters like BceAB require native conformation and ATPase activity to confer resistance, as mutations in NBDs abolish function .

  • AmyC may operate similarly, though direct evidence is pending .

Applications

  • Antimicrobial Research: Used to study transporter-mediated antibiotic resistance mechanisms .

  • Protein Engineering: Serves as a template for optimizing membrane protein expression systems .

  • Structural Biology: Aids in modeling ABC transporter dynamics via homology-based approaches .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preferred format in your order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize its inclusion in development.
Synonyms
melC; amyC; BSU30290; Melibiose/raffinose/stachyose import permease protein MelC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
amyC
Target Protein Sequence
MRAARTKSMRIITLLAAIVACAHFIPFYILLTTSLKAKGDYSSKWIFPADISFHNFSEAW ERASLGNSFINTMIITGFSALLLIIFGSLAAYPLARRETKLNKAVFALLISIMIIPPLTS MVPLYRMVVDAGMVNTHAIAIFINTAAYMPLTVFLYSGFIRSTIPKELVEAARIDGAGML KIFFTIVFPLLKPITATICIISCVFIWNDYQFAIFFLQDQKVQTLTVAMAGFFGENANNL HLVAAAALMAMLPMVVLFLALQKYFIAGLSSGAVKG
Uniprot No.

Target Background

Function
This protein is a component of the ABC transporter complex MelEDC-MsmX, which plays a role in the import of melibiose, raffinose, and stachyose. It is likely responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the AmyC permease protein in Bacillus subtilis and what is its role in the ABC transporter system?

AmyC functions as a putative transmembrane domain (TMD) component of an ABC transporter system in B. subtilis. ABC transporters typically consist of four core domains: two nucleotide binding domains (NBDs) that hydrolyze ATP and two transmembrane domains (TMDs) like AmyC that form channels for substrate transport across the cell membrane . Based on its classification and genomic context, AmyC likely participates in the transport or secretion of amylase or related substrates.

Experimental characterization of AmyC requires multiple approaches including gene deletion/overexpression studies, protein localization analyses, and transport assays. The relationship between AmyC and amylase production is particularly significant as B. subtilis is widely used for commercial production of amylases .

How is the amyC gene structured and regulated in the B. subtilis genome?

While specific regulatory elements for amyC aren't directly described in the search results, ABC transporter genes in B. subtilis are typically organized in operons with genes encoding permease components (like amyC) located adjacent to genes encoding the nucleotide-binding domains . The regulation likely responds to conditions relevant to amylase production and secretion.

Commercial amylase production strains often use defined promoters, such as the commercial sigA promoter P4199, to drive expression of genes in secretion pathways . To identify regulatory elements experimentally, researchers typically employ:

  • Promoter mapping with primer extension

  • Reporter gene fusions (e.g., amyC promoter-GFP)

  • ChIP-seq to identify transcription factor binding sites

  • RNA-seq under various conditions to identify expression patterns

What experimental methods are most effective for studying AmyC function?

Several complementary approaches are essential for comprehensive characterization of AmyC:

  • Genetic manipulation: Creating deletion mutants, point mutations, or overexpression strains using Splicing by Overlapping Extension (SOE) or automation-aided construction methods .

  • Protein localization: Fluorescent protein fusions to determine subcellular localization of AmyC within the cell membrane.

  • Functional assays: Measuring amylase secretion efficiency in wildtype versus amyC mutant strains. Amylase activity serves as an effective readout for evaluating secretion system performance .

  • Protein-protein interaction studies: Identifying interaction partners using co-immunoprecipitation or bacterial two-hybrid systems to map the complete transporter complex.

  • Transcriptomic analysis: RNA-seq to identify genes differentially expressed in amyC mutants compared to wildtype, similar to approaches used to study secretion stress .

How does AmyC interact with other components of the ABC transporter system?

As a putative permease protein, AmyC likely functions as one of the transmembrane domains (TMDs) in a complete ABC transporter. The architecture of ABC transporters in B. subtilis provides a model for AmyC's interactions. For example, the YtrBCDEF ABC transporter in B. subtilis consists of two nucleotide binding proteins (YtrB and YtrE), two transmembrane domain proteins (YtrC and YtrD), and a solute binding protein (YtrF) .

By analogy, AmyC likely interacts with:

  • A partner TMD to form the complete transmembrane channel

  • NBDs that bind and hydrolyze ATP to power substrate transport

  • Possibly substrate-binding proteins that capture and deliver substrates to the transporter

Determining these interactions requires techniques such as co-immunoprecipitation with tagged AmyC, bacterial two-hybrid screening, and crosslinking studies followed by mass spectrometry.

What phenotypic changes occur in B. subtilis when amyC is deleted or overexpressed?

If AmyC is involved in amylase secretion, deletion would likely lead to:

  • Reduced extracellular amylase activity

  • Intracellular accumulation of amylase, potentially causing secretion stress

  • Activation of stress response pathways

The accumulation of unfolded amylase proteins causes cellular stress that requires physiological adaptation for survival . Conversely, overexpression might enhance amylase secretion if AmyC is rate-limiting, but could also cause membrane stress due to excessive membrane protein insertion.

Comprehensive phenotypic characterization requires measuring growth rates in various media, quantifying extracellular and intracellular amylase activity, performing transcriptomic/proteomic analyses, and examining cell morphology via microscopy.

What mechanisms explain the dual functionality of AmyC in both transport and signaling processes?

Some ABC transporters in B. subtilis demonstrate dual functionality in both transport and sensing/signaling. For example, the BceAB-BceRS system functions both as a transporter and as part of a sensory complex . BceAB and the histidine kinase BceS form a sensory complex that detects bacitracin and activates a response regulator, controlling gene expression in a dose-dependent manner .

By analogy, AmyC might participate in:

  • Direct transport of amylase or related substrates

  • Sensing of secretion stress or substrate levels to regulate gene expression

This dual functionality likely involves conformational changes in AmyC that are detected by interaction partners, thereby coupling transport activity to signaling networks. Experimental investigation would require separation-of-function mutations that affect transport but not signaling (or vice versa).

How do post-translational modifications affect AmyC function?

While specific post-translational modifications of AmyC aren't described in the search results, several modifications could regulate its function:

  • Phosphorylation: Many bacterial transporters are regulated by phosphorylation cascades similar to those in two-component systems like BceRS .

  • Lipid modifications: As a membrane protein, AmyC function might be regulated by the lipid environment or direct lipid modifications.

  • Proteolytic processing: Partial proteolysis might regulate activity or stability of the transporter complex.

  • Disulfide bond formation: Oxidation state of cysteine residues might affect protein folding and function.

Investigating these modifications requires mass spectrometry analysis of purified AmyC, site-directed mutagenesis of potential modification sites, and comparative analysis of AmyC modifications under different physiological conditions.

What structural features of AmyC contribute to substrate specificity?

While specific structural information about AmyC isn't provided in the search results, insights can be drawn from other ABC transporters in B. subtilis. Permease proteins like BceB possess large extracellular loops (200-250 amino acids) that contain substrate-binding sites . Key structural features likely include:

  • Transmembrane helices forming the transport channel

  • Extracellular or periplasmic loops involved in substrate recognition

  • Cytoplasmic domains interacting with ATP-binding proteins

  • Specific amino acid residues lining the channel that determine substrate specificity

Engineering approaches to enhance function might include:

  • Site-directed mutagenesis of residues in the putative substrate-binding site

  • Domain swapping with related transporters that have different specificities

  • Directed evolution approaches selecting for enhanced transport

  • Computational design based on structural models

The automation-aided construction of B. subtilis strains described in search result could facilitate systematic engineering of AmyC variants.

How do environmental stressors impact AmyC expression and function?

Environmental factors likely affecting AmyC include:

  • Secretion stress: The accumulation of unfolded amylase proteins triggers a stress response that requires physiological adaptation . This secretion stress likely affects expression and function of proteins involved in the secretion pathway, potentially including AmyC.

  • Nutrient availability: ABC transporters in B. subtilis often respond to nutrient levels .

  • Growth phase: Expression patterns may vary between exponential and stationary phases.

  • Temperature and pH: These factors affect membrane fluidity and protein conformation.

  • Cell wall stress: If AmyC is involved in processes related to cell wall biosynthesis (as some ABC transporters are ), cell wall-targeting antibiotics might affect its expression.

Experimental approaches include qRT-PCR or RNA-seq under various stress conditions, reporter fusions to monitor expression in real-time, and measuring transport activity under different stress conditions.

What challenges exist in resolving contradictory data regarding AmyC's function?

Determining the precise function of ABC transporters can be challenging. For example, the mechanism of the BceAB transporter "has been investigated for nearly two decades and is still highly discussed" . Multiple mechanisms have been proposed, including functioning as an efflux transporter or importing and degrading substrates, but conclusive evidence has been elusive .

Challenges in resolving AmyC's specific role include:

  • Functional redundancy: Multiple transporters might have overlapping functions.

  • Context-dependency: Function might vary with growth conditions or genetic background.

  • Indirect effects: Deletion or overexpression might cause pleiotropic effects.

  • Technical challenges: Difficulties in purifying and reconstituting membrane proteins.

  • Complex interactions: AmyC might function as part of a larger complex.

Addressing these challenges requires conditional expression systems, complementary experimental approaches, in vitro reconstitution systems, and systems biology approaches to model complex interactions.

What protocols are most effective for purifying recombinant AmyC for structural studies?

For successful purification of AmyC, a membrane protein purification workflow should include:

  • Expression system selection:

    • E. coli with specialized membrane protein expression strains

    • B. subtilis expression systems (preserving native folding environment)

    • Cell-free expression systems for toxic membrane proteins

  • Affinity tag design:

    • C-terminal His-tag (less likely to interfere with membrane insertion)

    • Twin-Strep-tag for higher specificity

    • Placement at cytoplasmic terminus based on topology prediction

  • Membrane extraction:

    • Detergent screening (DDM, LMNG, or digitonin as starting points)

    • Gentle solubilization conditions to preserve native structure

    • Lipid-detergent mixtures to stabilize the protein

  • Purification steps:

    • Immobilized metal affinity chromatography

    • Size exclusion chromatography to remove aggregates

    • Quality control using SEC-MALS to confirm monodispersity

For structural studies specifically:

  • Nanodiscs or amphipols for cryo-EM studies

  • Lipidic cubic phase for crystallization attempts

  • Co-expression with interacting partners to stabilize the complex

How can reporter systems be optimized to study AmyC localization and dynamics?

Optimized reporter systems for AmyC studies should include:

  • Fluorescent protein fusions:

    • C-terminal or internal fusions (avoiding disruption of transmembrane domains)

    • msfGFP or mNeonGreen (brighter, more stable fluorescent proteins)

    • Photoconvertible proteins for pulse-chase dynamics

    • Split fluorescent protein systems for studying protein-protein interactions

  • Design considerations:

    • Flexible Gly-Ser linkers to minimize structural interference

    • Validation with functional assays to ensure the fusion maintains activity

    • Genomic integration at the native locus for physiological expression levels

  • Advanced imaging approaches:

    • Super-resolution microscopy for detailed localization

    • FRAP for measuring membrane dynamics

    • Single-molecule tracking to follow individual transporter complexes

  • Expression control:

    • Using defined promoters like P4199 for controlled expression

    • Combining with inducible degradation systems for temporal control

B. subtilis-specific considerations include managing autofluorescence challenges and using sporulation-deficient strains if necessary, similar to the ΔspoIIAC strain mentioned in search result .

What bioinformatic approaches can identify AmyC homologs across bacterial species?

A comprehensive bioinformatic analysis of AmyC homologs should include:

  • Sequence-based approaches:

    • BLASTp and PSI-BLAST searches against comprehensive databases

    • HMM-based searches using HMMER with custom profiles

    • Analysis of genomic context (adjacent genes often functionally related)

  • Structural predictions:

    • Transmembrane topology prediction

    • Secondary structure prediction

    • Template-based modeling using known ABC transporter structures

    • AlphaFold2 for structure prediction

  • Functional prediction:

    • Identification of conserved motifs characteristic of ABC transporters

    • Analysis of gene neighborhoods for functionally related genes

    • Substrate prediction based on conserved binding site residues

  • Evolutionary analysis:

    • Construction of phylogenetic trees to determine evolutionary relationships

    • Analysis of selective pressure on different domains

    • Identification of co-evolving residues

A phylogenetic analysis approach similar to that described for BceAB-like transporters, which revealed their distribution primarily in Firmicutes , would be valuable for understanding the taxonomic distribution of AmyC homologs.

How can CRISPR-Cas9 technology be applied to create precise mutations in amyC?

A comprehensive CRISPR-Cas9 strategy for amyC functional studies should include:

  • System design for B. subtilis:

    • SpCas9 or smaller Cas9 variants with appropriate promoters

    • Temperature-sensitive plasmids for transient expression

    • Integration at neutral genomic loci for stable expression

  • Guide RNA design:

    • Multiple guide RNAs targeting different regions of amyC

    • In silico prediction of off-target effects

    • Optimization of guide RNA sequence for B. subtilis expression

  • Repair template design:

    • Homology arms of 500-1000 bp

    • Introduction of silent mutations in the PAM region to prevent re-cutting

    • Inclusion of selection markers

  • Mutation strategies:

    • Point mutations in predicted functional residues

    • Domain swaps with homologous transporters

    • In-frame deletions of specific domains

  • Delivery methods:

    • Plasmid-based delivery with selection

    • Direct transformation with ribonucleoprotein complexes

    • Integration via natural competence (B. subtilis is naturally competent)

The automation-aided construction approach described in search result could be adapted for high-throughput CRISPR-based mutation of amyC to create a comprehensive mutation library.

What strategies resolve technical challenges in AmyC crystallization?

Strategies to overcome challenges in crystallizing membrane proteins like AmyC include:

  • Construct optimization:

    • Systematic truncation to remove flexible regions

    • Surface entropy reduction

    • Fusion with crystallization chaperones (T4 lysozyme, BRIL)

    • Antibody fragment co-crystallization

  • Protein stability enhancement:

    • Thermostability assays to identify optimal buffer conditions

    • Ligand or substrate addition to stabilize specific conformations

    • Disulfide engineering to restrict conformational flexibility

  • Detergent and lipid optimization:

    • Systematic detergent screening

    • Lipid cubic phase crystallization

    • Bicelle formulations with native-like lipid composition

    • Nanodiscs to maintain native environment

  • Alternative approaches:

    • Cryo-electron microscopy (less dependent on crystal formation)

    • X-ray free electron laser (XFEL) for microcrystals

    • NMR for structural analysis of specific domains

  • Complex formation:

    • Co-crystallization with interacting partners

    • Capture of different conformational states (ATP-bound, substrate-bound)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.