Recombinant Bacillus subtilis Putative efflux system component yhbJ (yhbJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. To ensure preferential development of a specific tag, please specify your requirements.
Synonyms
yhbJ; BSU09000; Putative efflux system component YhbJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yhbJ
Target Protein Sequence
MIEDETKGENKMNRGRLILTNIIGLIVVLAIIAGGAYYYYQSTNYVKTDEAKVAGDMAAI TAPAAGKVSDWDLDEGKTVKKGDTVAKIKGEQTVDVKSIMDGTIVKNEVKNGQTVQAGTT IAQTIDMDNLYITANIKETDIADIEVGNSVDVVVDGDPDTTFDGTVEEIGYATNSTFDML PSTNSSGNYTKVTQKVPVKISIKNPSDKVLPGMNASVKISE
Uniprot No.

Target Background

Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the YhbJ protein in Bacillus subtilis and what is its predicted function?

YhbJ is classified as a putative efflux system component in Bacillus subtilis. The protein is encoded by the yhbJ gene (Gene ID: 936216) in B. subtilis subsp. subtilis str. 168 and has been assigned the UniProt ID O31593 . Based on comparative studies with other bacterial species, YhbJ likely functions as part of a multidrug efflux pump system that contributes to antimicrobial resistance by actively transporting compounds out of the cell. Although specific substrates for B. subtilis YhbJ have not been comprehensively characterized, it shares structural similarities with other bacterial efflux systems that extrude antibiotics, biocides, heavy metals, and other potentially harmful compounds .

What expression systems are recommended for recombinant production of B. subtilis YhbJ?

For recombinant expression of B. subtilis YhbJ, E. coli and yeast expression systems have proven effective . When selecting an expression system, researchers should consider:

  • E. coli expression: Provides high yield and is relatively straightforward for bacterial proteins. Common strains include BL21(DE3) or Rosetta for proteins with rare codons.

  • Yeast expression: Offers post-translational modifications that might be important for certain applications, particularly if eukaryotic-like glycosylation patterns are required.

The choice depends on experimental objectives and downstream applications. For structural studies requiring large protein quantities, E. coli systems typically offer higher yields. For functional studies where proper folding is critical, yeast systems might provide advantages .

What purification strategies yield the highest purity of recombinant YhbJ protein?

For efficient purification of His-tagged YhbJ protein, a multi-step purification protocol is recommended:

  • Initial IMAC (Immobilized Metal Affinity Chromatography): Using Ni-NTA or Co-NTA resins with a stepwise imidazole gradient (10-250 mM).

  • Size Exclusion Chromatography (SEC): To separate aggregates and achieve >90% purity.

  • Optional Ion Exchange Chromatography: For applications requiring ultra-high purity (>95%).

This approach typically yields protein with >80% purity as determined by SDS-PAGE . For membrane-associated proteins like efflux components, addition of mild detergents (0.05-0.1% DDM or LDAO) during purification can improve yield and stability. Storage in PBS buffer at -80°C maintains protein integrity for extended periods .

How can researchers distinguish YhbJ from other efflux system components in B. subtilis?

Distinguishing YhbJ from other efflux system components requires a multi-faceted approach:

  • Sequence homology analysis: Compare with known efflux components in related organisms using tools like BLAST.

  • Domain architecture analysis: YhbJ contains specific domains characteristic of efflux components that can be identified through protein family databases.

  • Functional assays: Measure efflux activity using fluorescent substrates (e.g., ethidium bromide, Nile Red) in wild-type vs. yhbJ knockout strains.

  • Co-purification studies: Identify protein-protein interactions with other known efflux system components.

  • Phylogenetic comparison: Analyze evolutionary relationships with characterized efflux components from other bacteria, particularly in comparison to RND family efflux systems in E. coli that have been extensively characterized .

This comparative approach allows researchers to position YhbJ within the context of bacterial efflux systems while determining its unique characteristics.

What experimental approaches are most effective for determining YhbJ substrate specificity?

To determine YhbJ substrate specificity, multiple complementary approaches should be employed:

  • Genetic deletion studies: Compare antimicrobial susceptibility profiles between wild-type B. subtilis and ΔyhbJ strains against a panel of at least 20-30 diverse compounds (antibiotics, dyes, detergents, biocides).

  • Direct transport assays: Use fluorescent or radioactively labeled putative substrates to measure efflux rates in membrane vesicles expressing YhbJ.

  • Resistance complementation: Express yhbJ in a heterologous host lacking endogenous efflux capacity and assess restored resistance.

  • Binding studies: Employ isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to measure direct interactions between purified YhbJ and potential substrates.

  • Competition assays: Use a known substrate with measurable efflux and test competition with unlabeled compounds.

This multi-method approach helps overcome limitations of any single assay while generating a comprehensive substrate profile.

What is known about the protein-protein interactions of YhbJ in the context of efflux systems?

Studies of bacterial efflux systems suggest that YhbJ likely functions as part of a multi-component complex. Drawing parallels from well-characterized RND efflux systems in E. coli, we can hypothesize about potential interaction partners:

  • Periplasmic adaptor proteins: Similar to AcrA in the AcrAB-TolC system of E. coli, YhbJ may interact with adaptor proteins that connect inner and outer membrane components .

  • Outer membrane channels: Interaction with TolC-like outer membrane proteins would be necessary for complete efflux function across both membranes .

  • Regulatory proteins: Small accessory proteins similar to AcrZ in E. coli may modulate YhbJ function or substrate specificity .

To experimentally verify these interactions, co-immunoprecipitation, bacterial two-hybrid assays, or cross-linking studies would be appropriate. Additionally, genetic approaches examining synthetic phenotypes when multiple efflux components are deleted can reveal functional interactions.

How can genetic code expansion techniques be applied to study YhbJ structure-function relationships?

Genetic code expansion provides powerful tools for precise interrogation of YhbJ structure-function relationships. The approach has been successfully implemented in B. subtilis as demonstrated in recent research :

  • Site-specific incorporation of photo-crosslinking amino acids: Non-standard amino acids (nsAAs) such as p-benzoyl-L-phenylalanine (pBpa) can be incorporated at predicted interaction interfaces to capture transient protein-protein interactions through UV-activated crosslinking.

  • Click chemistry-compatible nsAAs: Incorporating azide or alkyne-containing amino acids allows for selective labeling of YhbJ with fluorophores or affinity tags for visualization or pull-down experiments.

  • Environmentally-sensitive nsAAs: Amino acids with fluorescent properties that respond to local environment changes can report on conformational changes during substrate binding or transport.

Implementation requires:

  • A suitable orthogonal aminoacyl-tRNA synthetase/tRNA pair

  • Optimized expression conditions for B. subtilis

  • Strategic selection of amber (TAG) codon positions

The genetic code expansion systems demonstrated in B. subtilis can incorporate up to 20 distinct nsAAs using different synthetase families , providing versatile options for YhbJ functional studies.

What role might YhbJ play in antibiotic resistance mechanisms in B. subtilis?

The putative role of YhbJ in antibiotic resistance requires systematic investigation through several experimental approaches:

  • Minimum Inhibitory Concentration (MIC) determination: Compare wild-type and ΔyhbJ strains against a panel of antibiotics to identify classes affected by YhbJ-mediated efflux.

  • Expression correlation studies: Analyze whether yhbJ expression increases in response to antibiotic stress using qRT-PCR or reporter fusions.

  • Evolution experiments: Subject B. subtilis to gradually increasing antibiotic concentrations and monitor changes in yhbJ expression or sequence.

  • Comparative genomics: Analyze yhbJ conservation and variation across B. subtilis strains with different antibiotic resistance profiles.

How might stress conditions affect YhbJ expression and function?

Bacterial efflux systems often respond to environmental stressors. To investigate YhbJ regulation under stress:

  • Transcriptional profiling: Use RNA-seq or qRT-PCR to measure yhbJ expression under various stresses (pH shifts, oxidative stress, membrane stress, nutrient limitation).

  • Promoter analysis: Identify stress-responsive regulatory elements in the yhbJ promoter region through reporter fusion constructs with systematic promoter mutations.

  • Stress survival assays: Compare survival of wild-type and ΔyhbJ strains under various stress conditions.

Drawing from knowledge of E. coli efflux systems, we might expect yhbJ expression to be controlled by stress-responsive regulators. For instance, in E. coli, the MdtEF system is regulated by acid resistance regulators GadX, GadY, and GadE, while MdtABC is controlled by the envelope stress response system BaeSR . Analogous stress-responsive regulation may exist for yhbJ in B. subtilis.

How does YhbJ from B. subtilis compare structurally and functionally to homologous proteins in other bacteria?

Comparative analysis of YhbJ can provide valuable insights into its function. Key approaches include:

  • Sequence alignment and conservation analysis: Identify highly conserved residues likely critical for function.

  • Structural homology modeling: Using solved structures of related proteins (such as AcrB or MdtBC from E. coli) as templates to predict YhbJ structure .

  • Heterologous complementation: Test whether B. subtilis YhbJ can complement function in efflux-deficient strains of other bacteria.

  • Domain architecture comparison: Analyze if YhbJ contains domains similar to the well-characterized domains in E. coli efflux proteins:

    • Substrate binding domain

    • Transmembrane domain

    • Porter domain

    • Funnel domain

Functional differences may reflect the distinct cell envelope architecture of Gram-positive bacteria like B. subtilis compared to Gram-negative bacteria like E. coli.

What is the evolutionary significance of YhbJ conservation across Bacillus species?

The evolutionary context of YhbJ can be explored through:

  • Phylogenetic analysis: Construct phylogenetic trees of YhbJ homologs across Bacillus species and related genera.

  • Synteny analysis: Examine conservation of gene neighborhood around yhbJ to identify functionally related genes.

  • Selection pressure analysis: Calculate Ka/Ks ratios to determine if yhbJ is under purifying, neutral, or positive selection.

  • Horizontal gene transfer assessment: Analyze GC content and codon usage to identify potential horizontal acquisition events.

Conservation patterns may reveal specialized adaptations to environmental niches or common selective pressures across Bacillus species. This evolutionary perspective can inform hypotheses about YhbJ's biological significance beyond individual species.

What are the key considerations for designing a yhbJ knockout or knockdown system in B. subtilis?

Creating effective yhbJ genetic manipulation systems requires careful consideration of several factors:

  • Clean deletion strategy: Use marker-less deletion techniques to avoid polar effects on neighboring genes.

  • Complementation controls: Include plasmid-based or chromosomal integration of yhbJ for rescue experiments.

  • Conditional systems: If yhbJ is essential under certain conditions, consider:

    • Inducible promoter replacement

    • CRISPR interference (CRISPRi) for tunable repression

    • Destabilization domain fusion for protein-level control

  • Validation approaches:

    • RT-PCR to confirm transcript elimination

    • Western blotting to verify protein absence

    • Phenotypic assays to confirm functional consequences

For B. subtilis specifically, integration at the amyE locus provides stable expression for complementation constructs. The pDR111 plasmid series with IPTG-inducible Phyper-spank promoters offers well-characterized expression control .

What analytical techniques are most suitable for monitoring YhbJ-mediated efflux in real-time?

Real-time monitoring of efflux activity requires sensitive detection methods:

TechniquePrincipleAdvantagesLimitations
Fluorescent substrate accumulationMeasures intracellular retention of fluorescent efflux substrates (e.g., ethidium bromide, Nile Red)- Real-time measurements
- Works with intact cells
- Quantitative
- Limited to fluorescent substrates
- Potential for substrate interference
FRET-based sensorsEngineered sensors that undergo FRET changes upon substrate binding/transport- Highly specific
- Can detect conformational changes
- Requires extensive sensor development
- May affect protein function
pH-sensitive fluorophoresDetects proton antiport coupled to efflux- Can measure energetics
- Works with non-fluorescent substrates
- Indirect measurement
- Affected by other proton-coupled processes
Surface plasmon resonance (SPR)Measures direct binding of substrates to purified protein- Direct binding measurement
- Label-free detection
- Requires purified protein
- Not in native membrane environment
ElectrophysiologyMeasures substrate-induced currents in reconstituted systems- Direct functional measurement
- Quantitative kinetics
- Technically challenging
- Requires specialized equipment

For YhbJ specifically, establishing a reliable fluorescent substrate assay would provide the most accessible entry point for real-time efflux monitoring.

How can researchers distinguish between direct and indirect effects when studying yhbJ deletion phenotypes?

Distinguishing direct from indirect effects requires rigorous experimental design:

  • Complementation studies: Full restoration of wild-type phenotype upon expression of functional YhbJ confirms direct relationship.

  • Dose-dependency: Using inducible expression systems to create a range of YhbJ levels can reveal quantitative relationships between protein abundance and phenotype.

  • Point mutants: Creating catalytically inactive versions through targeted mutations can separate structural from functional roles.

  • Temporal analysis: Examining how quickly phenotypes manifest after YhbJ depletion helps distinguish primary from secondary effects.

  • Suppressor screening: Identifying mutations that restore function in ΔyhbJ backgrounds can reveal functional pathways.

  • Biochemical validation: Demonstrating direct substrate transport in reconstituted systems provides unequivocal evidence of direct effects.

This multi-faceted approach is particularly important for membrane proteins like efflux pumps, which can have pleiotropic effects when deleted.

What emerging technologies might advance our understanding of YhbJ function?

Several cutting-edge technologies show promise for deepening our understanding of YhbJ:

  • Cryo-electron microscopy: For determining high-resolution structures of YhbJ alone or in complex with interaction partners, especially as methods for membrane proteins continue to improve.

  • Native mass spectrometry: To identify the complete composition of YhbJ-containing complexes and their stoichiometry.

  • Single-molecule tracking: To visualize YhbJ localization and dynamics in living cells.

  • Microfluidics-based assays: For high-throughput screening of substrate specificity and inhibitor discovery.

  • Deep mutational scanning: To comprehensively map structure-function relationships by assessing the impact of thousands of mutations simultaneously.

These approaches, combined with genetic code expansion techniques already demonstrated in B. subtilis , could dramatically accelerate our understanding of this putative efflux system component.

How might YhbJ function integrate with broader cellular processes and stress responses?

Understanding YhbJ in the context of cellular physiology requires systems-level approaches:

  • Global interaction mapping: Techniques like BioID or APEX proximity labeling can identify proteins that physically interact with YhbJ in vivo.

  • Metabolomics: Comparing metabolite profiles between wild-type and ΔyhbJ strains under various conditions can reveal unexpected connections to metabolic pathways.

  • Transcriptomics: RNA-seq analysis comparing gene expression changes in response to yhbJ deletion can identify compensatory pathways and regulatory networks.

  • Cell envelope stress response integration: Investigate connections between YhbJ and known envelope stress response pathways, similar to how E. coli efflux systems connect to envelope stress via regulators like BaeSR and CpxRA .

These approaches may reveal unexpected functions beyond the predicted role in antimicrobial efflux, potentially connecting YhbJ to fundamental cellular processes like division, envelope homeostasis, or adaptation to environmental niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.