Recombinant Bacillus subtilis Putative enoyl-CoA hydratase/isomerase yhaR (yhaR)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yhaR; BSU09880; Putative enoyl-CoA hydratase/isomerase YhaR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yhaR
Target Protein Sequence
MEFVQYACNGAVAEIILNRPDAHHALNEQMLSELKEAVEMAAASEALIVLLRGSGKGFSA GGDIRMMTSEHDPDQFKRLMDTIEAVTLNLYQMKKVTIAAIHGAAAGLGLSLALCADIVL AEKNAVLAMNFIGIGLVPDGGGHYLLKKRIGEAKAKKLIWSGKKLSASEAADMGLLDGTF AGDPAEGARPIIETLLASPLLAMIETKGIFQSLQIEELKKVLSLERSAQERMRRTKDHQE GIRAFLEKREPKFQA
Uniprot No.

Target Background

Database Links
Protein Families
Enoyl-CoA hydratase/isomerase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted function of yhaR in Bacillus subtilis?

yhaR is classified as a putative enoyl-CoA hydratase/isomerase in Bacillus subtilis, likely functioning within fatty acid metabolism pathways. As a member of the crotonase superfamily, yhaR is predicted to catalyze the reversible addition of water to α,β-unsaturated enoyl-CoA thioesters. This enzymatic activity plays a crucial role in both the degradation (β-oxidation) and synthesis of fatty acids. Based on sequence homology analysis with other characterized enoyl-CoA hydratases, yhaR likely contains conserved catalytic glutamate residues essential for substrate binding and catalysis, similar to those identified in other bacterial enoyl-CoA hydratases such as DspI in Pseudomonas aeruginosa . When designing experiments to confirm yhaR function, researchers should consider both enzymatic activity assays and genetic knockout studies to observe metabolic effects.

How does yhaR compare structurally to other characterized enoyl-CoA hydratases?

Sequence alignment analyses suggest that yhaR shares significant structural similarities with other bacterial enoyl-CoA hydratases, particularly in the catalytic domain. Like other members of the crotonase superfamily, yhaR likely possesses conserved glutamate residues critical for substrate binding and catalysis. Drawing parallels from the DspI protein in P. aeruginosa, these catalytic residues would correspond to positions similar to Glu126 and Glu146 in DspI, which align with the well-characterized Glu144 and Glu164 in rat mitochondrial enoyl-CoA hydratase . For conclusive structural characterization, researchers should perform X-ray crystallography or cryo-EM studies of purified recombinant yhaR to determine its three-dimensional structure, followed by site-directed mutagenesis of predicted catalytic residues to confirm their functional importance.

What are the optimal expression systems for producing recombinant yhaR in B. subtilis?

For efficient expression of recombinant yhaR in B. subtilis, several optimized approaches can be implemented:

  • Promoter selection: Utilizing strong, inducible promoters such as Pspac or PxylA allows for controlled expression. For higher yield, consider engineered strong constitutive promoters based on PvegI or P43 .

  • Expression strategy: Both plasmid-based autonomous expression and chromosomal integration approaches should be evaluated. While plasmid-based systems typically yield higher protein levels, chromosomal integration provides greater stability for long-term expression .

  • Strain optimization: Consider using protease-deficient strains such as WB800 or BRB08 to minimize degradation of the recombinant protein. These strains have mutations in multiple extracellular proteases, significantly improving yield .

  • Codon optimization: Analyze the codon usage of yhaR against the preferred codons in B. subtilis to optimize translation efficiency.

The following table summarizes expression systems for recombinant proteins in B. subtilis:

Expression SystemFeaturesAdvantagesLimitations
pHT vector seriesReplicative plasmids with various inducible promotersHigh copy number, controlled expressionPlasmid instability
pHCMC vector seriesθ-replicating vectorsStable maintenanceModerate copy number
Chromosomal integration (AmyE site)Single-copy chromosomal insertionStable inheritance, no selection neededLower expression level
SURE expression systemXylose-inducible, tight controlLinear dose-responseRequires carbon source management

What purification strategies yield the highest purity of recombinant yhaR?

Purification of recombinant yhaR from B. subtilis requires a multi-step approach tailored to both the protein's properties and the expression system:

  • Affinity tag selection: For initial capture, histidine (His6) tags are most commonly used, though other options include Strep-II tag or FLAG tag depending on experimental needs and downstream applications.

  • Secretion vs. cytoplasmic expression: B. subtilis offers excellent secretion abilities, which can simplify purification by directing yhaR to the culture medium. This requires optimization of signal peptides such as AprE, AmyE, or optimized synthetic signals .

  • Chromatography sequence:

    • Initial capture using IMAC (Immobilized Metal Affinity Chromatography) if His-tagged

    • Intermediate purification using ion exchange chromatography based on yhaR's predicted isoelectric point

    • Polishing step with size exclusion chromatography to achieve high purity

  • Buffer optimization: Screening different buffer compositions, pH values, and salt concentrations is critical for maintaining yhaR stability and activity throughout purification.

For membrane-associated forms of yhaR, incorporate detergent screening to identify optimal solubilization conditions that maintain native protein conformation and activity.

How can the catalytic activity of yhaR be assessed experimentally?

To characterize the enzymatic activity of yhaR, researchers should implement a multi-faceted approach:

  • Spectrophotometric assays: Monitor the hydration of enoyl-CoA substrates by tracking absorbance changes at 263 nm, which corresponds to the loss of α,β-unsaturated double bonds.

  • HPLC-based methods: Separate and quantify substrate depletion and product formation using reversed-phase HPLC coupled with UV detection or mass spectrometry.

  • Substrate panel screening: Test yhaR activity against various chain-length enoyl-CoA substrates (C4-C16) to determine substrate preference. Include both straight-chain and branched substrates to fully characterize specificity.

  • Kinetic parameter determination:

    • Calculate Km and kcat values for preferred substrates

    • Evaluate the effects of temperature, pH, and metal ions on activity

    • Determine inhibition patterns with known enoyl-CoA hydratase inhibitors

  • Complementation studies: Assess whether yhaR can functionally complement enoyl-CoA hydratase-deficient strains of bacteria, which would provide physiological confirmation of its predicted activity.

When characterizing a putative enzyme like yhaR, it's essential to rule out contaminating activities by including appropriate negative controls, such as heat-inactivated enzyme preparations and reactions with catalytically-inactive mutants created through site-directed mutagenesis of predicted catalytic residues.

What methodologies are most effective for studying protein-protein interactions involving yhaR?

To elucidate the protein interaction network of yhaR:

  • Co-immunoprecipitation (Co-IP): Use antibodies against tagged yhaR to pull down protein complexes from B. subtilis lysates, followed by mass spectrometry identification of binding partners.

  • Bacterial two-hybrid systems: Adapt bacterial two-hybrid systems for use in B. subtilis to screen for potential interaction partners.

  • Cross-linking coupled with mass spectrometry: Utilize chemical cross-linkers to stabilize transient interactions, followed by proteolytic digestion and LC-MS/MS analysis to identify interaction partners and interfaces.

  • Fluorescence resonance energy transfer (FRET): Express yhaR fused to a fluorescent protein along with potential interaction partners tagged with complementary fluorophores to monitor interactions in vivo.

  • Surface plasmon resonance (SPR): Quantitatively measure binding affinities and kinetics between purified yhaR and candidate interacting proteins.

For structural characterization of protein complexes, combine these approaches with techniques such as cryo-electron microscopy or X-ray crystallography of co-purified complexes.

What genetic tools are most effective for studying yhaR function in B. subtilis?

B. subtilis offers numerous genetic manipulation tools that can be applied to study yhaR function:

  • CRISPR-Cas9 genome editing: Recent adaptations of CRISPR-Cas9 for B. subtilis allow precise genome modifications including gene deletions, insertions, and point mutations at the native yhaR locus .

  • Marker-free deletion systems: Counter-selectable markers like mazF toxin or upp (encoding uracil phosphoribosyltransferase) allow clean deletions without antibiotic resistance genes.

  • Inducible expression systems: Tight control of yhaR expression using xylose-inducible (PxylA), IPTG-inducible (Pspac), or subtilin-inducible (SURE) promoters enables studies of concentration-dependent effects.

  • Reporter gene fusions: Translational fusions with fluorescent proteins (GFP, mCherry) or enzymatic reporters (β-galactosidase) help track expression, localization, and regulation of yhaR.

  • Transposon mutagenesis libraries: For identifying genetic interactions, TnYLB-1 mariner-based transposon systems adapted for B. subtilis allow saturating mutagenesis followed by phenotypic screening.

The following table summarizes genetic manipulation tools specifically optimized for B. subtilis:

Genetic ToolApplicationAdvantagesConsiderations
CRISPR-Cas9Precise genome editingMarker-free, multiplex capabilityPAM site requirements
pMUTIN vector seriesInsertional gene disruptionSingle-crossover integrationPolar effects possible
pDR111/pDG1664amyE locus integrationStable expressionSingle copy
Mariner transposonsRandom mutagenesisSaturating coverageSecondary screening needed
Genetic code expansionIncorporation of nsAAsSite-specific labelingRequires orthogonal tRNA/aaRS pairs

How can site-directed mutagenesis be used to identify catalytic and structural residues in yhaR?

Site-directed mutagenesis represents a powerful approach to dissect the structure-function relationships of yhaR:

  • Target selection strategy:

    • Catalytic residues: Based on alignment with characterized enoyl-CoA hydratases, prioritize conserved glutamate residues analogous to the Glu126 and Glu146 identified in DspI of P. aeruginosa .

    • Substrate binding pocket: Identify residues forming the hydrophobic pocket that accommodates the fatty acyl chain.

    • Structural elements: Target residues in predicted secondary structure elements to assess their contribution to protein folding and stability.

  • Mutagenesis approach:

    • For catalytic residues: Create conservative (E→D) and non-conservative (E→A or E→Q) mutations to distinguish between roles in catalysis versus structural integrity.

    • For substrate specificity: Create libraries with mutations at residues lining the substrate binding pocket to alter chain-length preference.

  • Evaluation methods:

    • Enzyme kinetics: Compare kcat/Km values between wild-type and mutant proteins.

    • Thermal stability: Use differential scanning fluorimetry (DSF) to assess effects on protein stability.

    • Substrate specificity: Test activity against a panel of enoyl-CoA substrates with varying chain lengths.

  • Technical considerations:

    • Use the QuikChange method or inverse PCR for mutations in expression plasmids.

    • For chromosomal mutations, implement CRISPR-Cas9 editing for marker-free modifications at the native locus.

    • Confirm all mutations by sequencing before functional characterization.

How can genetic code expansion be applied to study yhaR structure and function?

Genetic code expansion technologies, recently demonstrated in B. subtilis , offer powerful approaches for studying yhaR:

  • Site-specific incorporation of non-standard amino acids (nsAAs):

    • Photocrosslinking amino acids (like p-benzoyl-L-phenylalanine) can be incorporated at predicted interaction interfaces to capture transient protein-protein interactions.

    • Fluorescent amino acids enable direct visualization of protein localization and conformational changes without bulky fluorescent protein tags.

    • Bioorthogonal reactive groups allow for selective chemical modifications post-translation.

  • Implementation strategy:

    • Select appropriate orthogonal tRNA/aminoacyl-tRNA synthetase pairs that function efficiently in B. subtilis.

    • Identify permissive sites within yhaR that tolerate nsAA incorporation without disrupting function.

    • Optimize expression conditions to maximize incorporation efficiency.

  • Applications for yhaR research:

    • Map the substrate binding pocket using photocrosslinking nsAAs.

    • Study conformational changes during catalysis with environmentally sensitive fluorescent nsAAs.

    • Investigate in vivo dynamics using bioorthogonally-labeled yhaR.

This cutting-edge approach requires careful optimization of the genetic code expansion machinery for B. subtilis, but offers unprecedented insights into protein structure-function relationships that traditional mutagenesis cannot provide.

What is the role of yhaR in the fatty acid metabolism network of B. subtilis?

Understanding yhaR's role in the broader metabolic network requires an integrative systems biology approach:

  • Metabolic flux analysis:

    • Compare flux distributions in wild-type vs. ΔyhaR strains using 13C-labeled substrates.

    • Identify metabolic bottlenecks or redirections resulting from yhaR deletion.

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data to map changes in metabolic networks upon yhaR perturbation.

    • Use correlation network analysis to identify genes co-regulated with yhaR.

  • Regulatory network mapping:

    • Identify transcription factors controlling yhaR expression through promoter dissection and chromatin immunoprecipitation.

    • Characterize post-translational modifications affecting yhaR activity.

  • Comparative genomics approach:

    • Analyze gene neighborhood and synteny of yhaR across Bacillus species to identify functional associations.

    • Compare metabolic capabilities of species with and without yhaR homologs.

  • Physiological context determination:

    • Assess growth of ΔyhaR strains on different carbon sources to identify specific metabolic dependencies.

    • Test effects of environmental stressors on yhaR expression and activity.

Create a comprehensive model of yhaR's metabolic role through iterative experimental validation and computational modeling, placing this enzyme within the context of B. subtilis metabolism and stress response pathways.

How can researchers overcome solubility issues when expressing recombinant yhaR?

Enoyl-CoA hydratases/isomerases can present solubility challenges during heterologous expression. To address these issues:

  • Fusion tag optimization:

    • Test solubility-enhancing fusion partners such as MBP, SUMO, or Fh8.

    • Compare N-terminal vs. C-terminal tag placement for optimal solubility.

    • Include TEV or PreScission protease sites for tag removal without affecting protein structure.

  • Expression condition screening:

    • Reduce cultivation temperature (16-25°C) during induction phase.

    • Test induction at different growth phases (early, mid, or late logarithmic).

    • Optimize inducer concentration to balance expression rate with folding capacity.

  • Media and additive optimization:

    • Supplement growth media with osmolytes (glycerol, sorbitol) to stabilize protein folding.

    • Add specific cofactors or substrate analogs during expression.

    • Test minimal versus rich media formulations for optimal soluble expression.

  • Co-expression strategies:

    • Co-express molecular chaperones (GroEL/ES, DnaK/J) to assist protein folding.

    • Consider co-expression with physiological interaction partners that may stabilize yhaR.

  • In-cell solubility assessment:

    • Use split-GFP systems to rapidly screen solubility in various conditions.

    • Implement high-throughput screening of expression libraries to identify solubility-enhancing mutations.

While B. subtilis has efficient protein secretion capabilities that might aid in obtaining soluble protein , targeting yhaR for secretion requires careful signal peptide optimization and monitoring to ensure the enzyme maintains its native conformation and activity.

What are the most reliable controls for validating putative yhaR enzyme activity?

Rigorous experimental controls are essential for confirming that observed enzymatic activity can be attributed specifically to yhaR:

  • Negative controls:

    • Heat-inactivated enzyme preparations to control for non-enzymatic reactions.

    • Active-site mutants (E→A substitutions at catalytic glutamates) to confirm activity dependence on predicted catalytic residues.

    • Buffer-only and empty vector expression controls to account for background activity.

  • Positive controls:

    • Well-characterized enoyl-CoA hydratases from other organisms (e.g., E. coli FadB) tested under identical conditions.

    • Commercial enoyl-CoA hydratase (if available) as activity benchmark.

  • Specificity controls:

    • Test activity with structurally similar non-substrate molecules to confirm substrate specificity.

    • Assess activity in the presence of known enoyl-CoA hydratase inhibitors.

    • Perform activity assays with varying enzyme concentrations to confirm linear relationship with reaction rate.

  • Technical validation:

    • Confirm activity using multiple, independent assay methods (spectrophotometric, HPLC, coupled enzyme assays).

    • Verify that reaction products have the expected chemical structure via mass spectrometry or NMR.

    • Demonstrate reversibility of the reaction under appropriate conditions.

  • Physiological validation:

    • Perform complementation experiments in enoyl-CoA hydratase-deficient strains.

    • Correlate in vitro kinetic parameters with in vivo metabolic phenotypes.

The following table presents a systematic approach to control experiments for validating yhaR activity:

Control TypeExperimentExpected Outcome if yhaR is ActiveData Interpretation
Enzyme dependencyVarying enzyme concentrationLinear relationship with initial velocityConfirms enzymatic nature
Catalytic residueE→A mutations at predicted catalytic sitesSubstantial decrease in activityConfirms specific catalytic mechanism
Substrate specificityActivity with non-substrate analogsMinimal or no activityConfirms substrate selectivity
Time courseActivity measured at multiple timepointsProduct formation plateaus at substrate depletionConfirms completion of enzymatic reaction
InhibitionKnown enoyl-CoA hydratase inhibitorsDose-dependent inhibitionConfirms shared mechanism with known enzymes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.