Recombinant Bacillus subtilis Putative glycosyltransferase CsbB (csbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
csbB; yfhN; BSU08600; Putative glycosyltransferase CsbB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
csbB
Target Protein Sequence
MKQGLISIIIPSYNEGYNVKLIHESLKKEFKNIHYDYEIFFINDGSVDDTLQQIKDLAAT CSRVKYISFSRNFGKEAAILAGFEHVQGEAVIVMDADLQHPTYLLKEFIKGYEEGYDQVI AQRNRKGDSFVRSLLSSMYYKFINKAVEVDLRDGVGDFRLLSRQAVNALLKLSEGNRFSK GLFCWIGFDQKIVFYENVERKNGTSKWSFSSLFNYGMDGVVSFNHKPLRLCFYTGIFILL LSIIYIIATFVKILTNGISVPGYFTIISAVLFLGGVQLLSLGIIGEYIGRIYYETKKRPH YLIKEANIPNKDLPETNELKSMRRLTKMH
Uniprot No.

Target Background

Database Links
Protein Families
Glycosyltransferase 2 family, GtrB subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CsbB in Bacillus subtilis?

CsbB is a gene in Bacillus subtilis that encodes a putative glycosyltransferase protein of 329 amino acid residues. The protein contains two potential membrane-spanning segments in its C-terminal region, suggesting it is membrane-associated. It was identified as part of the general stress response system in B. subtilis and is under the dual control of a sigma B-dependent and a sigma B-independent promoter . The gene name "csb" stands for "controlled by sigma B," reflecting its regulation by this alternative transcription factor that activates during environmental stresses.

What is the functional role of CsbB?

CsbB functions as a glycosyltransferase that produces C55-P-GlcNAc (undecaprenyl phosphate-N-acetylglucosamine), which is subsequently transported across the membrane by another protein called GtcA. The GlcNAc moiety is then attached to lipoteichoic acid (LTA) in the cell wall . This activity suggests that CsbB plays a critical role in cell envelope modification during stress conditions. The predicted membrane-spanning segments in CsbB's C-terminal region support the hypothesis that it participates in modifying the cell envelope as part of the stress response mechanism .

How is CsbB regulated in B. subtilis?

CsbB expression is regulated through a dual promoter system. The primary regulatory mechanism involves sigma B (σB), an alternative transcription factor that becomes activated during environmental stresses in B. subtilis. This activation controls the expression of numerous unlinked genes, including csbB . Additionally, csbB is also under control of a sigma B-independent promoter, suggesting its expression can be regulated through multiple pathways depending on cellular conditions. This dual control mechanism may allow for fine-tuned expression of CsbB under various environmental conditions.

What is the protein structure of CsbB?

The CsbB protein consists of 329 amino acid residues with two predicted membrane-spanning segments located in its C-terminal region . While the complete three-dimensional structure has not been fully resolved in the provided research, comparative analysis with other glycosyltransferases suggests it likely adopts a typical glycosyltransferase fold. Unlike some related enzymes such as YngB, which has been crystalized and shows the typical fold of UTP-glucose-1-phosphate uridylyltransferases , the detailed structural information for CsbB appears more limited. The membrane-spanning segments suggest it is anchored to the cytoplasmic membrane, with catalytic domains likely positioned to facilitate the transfer of sugar moieties to lipid carriers.

What enzymatic activities are associated with CsbB?

CsbB functions as a glycosyltransferase that specifically catalyzes the formation of C55-P-GlcNAc . This enzymatic reaction involves the transfer of an N-acetylglucosamine (GlcNAc) moiety to undecaprenyl phosphate (C55-P), creating a lipid-linked sugar intermediate that serves as a precursor for cell wall modifications. This activity is critical for the subsequent transport of GlcNAc across the membrane by GtcA and its attachment to lipoteichoic acid. The specific catalytic mechanism likely involves the coordination of donor and acceptor substrates in an active site that facilitates glycosidic bond formation, similar to other glycosyltransferases in the GT family.

How does CsbB differ from other B. subtilis glycosyltransferases?

While B. subtilis possesses multiple glycosyltransferases like TagE (which transfers glucose onto wall teichoic acid using UDP-glucose as substrate) and UTP-glucose-1-phosphate uridylyltransferases like GtaB and YngB , CsbB is distinct in its specific role in stress response. Unlike YngB and GtaB, which are involved in UDP-glucose production, CsbB produces C55-P-GlcNAc and is specifically regulated by the stress-responsive sigma factor σB . This specialized function in stress response pathways distinguishes CsbB from general glycosyltransferases involved in routine cell wall synthesis.

How can I clone and express recombinant CsbB?

For cloning and expressing recombinant CsbB, researchers can follow this methodological approach:

  • PCR amplification of the csbB gene from B. subtilis genomic DNA using primers containing appropriate restriction sites

  • Cloning into an expression vector such as pET series with an N-terminal His-tag for purification

  • Transform into an appropriate E. coli expression strain such as BL21(DE3)

  • Culture cells in LB medium with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8

  • Induce expression with IPTG (0.1-1 mM) and lower temperature to 20-25°C for 16-18 hours to enhance soluble protein production

Because CsbB contains membrane-spanning segments, optimization steps may be necessary to improve soluble expression, such as:

  • Using specialized E. coli strains designed for membrane protein expression

  • Testing different detergents for extraction and purification

  • Constructing truncated versions that lack the membrane-spanning segments for soluble domain studies

What are effective purification protocols for CsbB?

Purification of recombinant CsbB requires special consideration due to its membrane-associated nature:

Protocol for CsbB purification:

  • Harvest cells by centrifugation (10,000 g, 30 minutes) following expression

  • Resuspend cell pellet in lysis buffer containing:

    • 50 mM MES buffer, pH 6.5

    • 0.1 mM PMSF (protease inhibitor)

    • 1 mg/mL lysozyme

    • 1 mM EDTA

    • 4 mM MgSO₄

    • 50 mM Na₂SO₄

    • Appropriate detergent (e.g., 1% n-dodecyl-β-D-maltoside) for membrane protein extraction

  • Incubate at 30°C for 1 hour to initiate cell lysis

  • Disrupt cells further using sonication or French press

  • Remove cell debris by centrifugation (10,000 g, 30 minutes)

  • Purify the His-tagged protein using Ni-NTA affinity chromatography

  • Elute with imidazole gradient (50-300 mM)

  • Perform size exclusion chromatography for further purification

For activity assays, it's crucial to maintain the protein in an appropriate detergent environment to preserve its native conformation and activity.

How can I assess CsbB glycosyltransferase activity in vitro?

The glycosyltransferase activity of CsbB can be assessed using the following approaches:

Radiometric assay:

  • Prepare reaction mixture containing:

    • Purified CsbB protein (1-5 μg)

    • UDP-[¹⁴C]GlcNAc or UDP-[³H]GlcNAc (donor substrate)

    • Undecaprenyl phosphate (acceptor substrate)

    • Buffer containing 50 mM MES (pH 6.5), 10 mM MgCl₂

  • Incubate at 30°C for 30-60 minutes

  • Stop reaction with chloroform:methanol (2:1)

  • Extract lipid-linked products and analyze by thin-layer chromatography

  • Quantify radioactivity using a scintillation counter

Coupled spectrophotometric assay:

  • Use a coupled enzyme system that detects UDP release

  • Prepare reaction mixture with:

    • Purified CsbB

    • UDP-GlcNAc

    • Undecaprenyl phosphate

    • Coupling enzymes (pyruvate kinase and lactate dehydrogenase)

    • Phosphoenolpyruvate

    • NADH

  • Monitor NADH oxidation at 340 nm as an indicator of glycosyltransferase activity

These methodologies provide quantitative assessment of CsbB enzymatic function under controlled conditions.

How does CsbB contribute to cell wall modification during stress?

Under stress conditions, B. subtilis activates the sigma B transcription factor, which upregulates csbB expression . CsbB then synthesizes C55-P-GlcNAc, which serves as a precursor for cell wall modifications . Research suggests these modifications may alter cell envelope properties to enhance resistance to various environmental stresses.

To investigate this relationship experimentally:

  • Create a reporter system using the csbB promoter fused to a fluorescent protein gene

  • Subject B. subtilis to various stresses (heat, salt, ethanol, acid)

  • Monitor csbB expression levels using fluorescence measurements

  • Compare cell wall composition between wild-type and csbB-deletion strains under stress conditions

  • Perform cell envelope integrity assays using dyes like propidium iodide

These approaches can reveal how CsbB-mediated modifications contribute to stress tolerance and cell envelope integrity during adverse conditions.

What is the relationship between CsbB and other cell wall modification enzymes?

To investigate the interplay between CsbB and other cell wall modification enzymes:

  • Perform comparative transcriptomic analysis of B. subtilis under stress conditions

  • Identify co-regulated genes involved in cell wall synthesis and modification

  • Generate single and double knockout mutants (e.g., csbB/gtaB, csbB/yngB, csbB/tagE)

  • Analyze cell wall composition in these mutants using specialized techniques:

    • Solid-state NMR to assess peptidoglycan structure

    • GC-MS to analyze cell wall sugar composition

    • LC-MS to identify cell wall lipid modifications

The research by Sargent et al. highlighted potential functional relationships between different glycosyltransferases in B. subtilis, including the roles of GtaB and YngB in UDP-glucose production and TagE in wall teichoic acid modification . Understanding how CsbB functions within this network is crucial for mapping the complete cell wall modification response during stress.

How can I design experiments to study CsbB localization and dynamics?

To study CsbB localization and dynamics in B. subtilis:

Fluorescent protein fusion approach:

  • Construct C-terminal or N-terminal GFP fusions of CsbB, avoiding disruption of membrane-spanning domains

  • Express the fusion protein from its native promoter to maintain physiological expression levels

  • Validate functionality of the fusion protein through complementation of a csbB deletion mutant

  • Use fluorescence microscopy to visualize CsbB localization under various conditions:

    • Normal growth conditions

    • Different stress conditions (heat, osmotic, oxidative)

    • During different growth phases

FRAP (Fluorescence Recovery After Photobleaching) analysis:

  • Use the GFP-CsbB fusion construct

  • Photobleach a specific region of the cell membrane

  • Monitor fluorescence recovery over time

  • Calculate diffusion coefficients to understand membrane dynamics of CsbB

These experimental approaches provide insights into the spatial and temporal regulation of CsbB activity during stress response.

Why might recombinant CsbB show low/no activity?

Several factors can contribute to low activity of recombinant CsbB:

  • Improper folding or membrane integration: CsbB contains membrane-spanning segments that require proper lipid environment for function

    • Solution: Use mild detergents during purification, consider membrane mimetics like nanodiscs or liposomes

  • Missing cofactors or interacting partners: CsbB may require specific ions or protein partners

    • Solution: Supplement reaction buffer with various divalent cations (Mg²⁺, Mn²⁺, Ca²⁺)

  • Substrate specificity issues: Incorrect donor or acceptor substrates

    • Solution: Test various UDP-sugar donors and lipid acceptors

  • Protein degradation: C-terminal or N-terminal degradation affecting activity

    • Solution: Add protease inhibitors during purification, verify protein integrity by Western blot

A systematic approach testing these variables can help restore enzymatic activity of recombinant CsbB.

How can I optimize CsbB expression and stability?

To optimize CsbB expression and stability, researchers should consider:

Expression optimization table:

ParameterOptions to testNotes
E. coli strainBL21(DE3), C41(DE3), C43(DE3), RosettaC41/C43 are specialized for membrane proteins
Expression temperature16°C, 20°C, 25°C, 30°CLower temperatures often improve folding
IPTG concentration0.05 mM, 0.1 mM, 0.5 mM, 1.0 mMLower IPTG can reduce aggregation
MediaLB, TB, 2×YT, M9Rich media may improve yields
Induction OD₆₀₀0.4, 0.6, 0.8, 1.0Optimal cell density for induction
AdditivesGlycerol (5%), Glucose (0.5%), Ethanol (1%)May improve protein folding

Stability enhancement approaches:

  • Include glycerol (10-20%) in all buffers

  • Add appropriate detergents (DDM, LDAO, or OG) above critical micelle concentration

  • Maintain constant cold temperature (4°C) during purification

  • Consider adding specific lipids (phosphatidylcholine, cardiolipin) to mimic native membrane environment

  • Test different buffer systems (MES, HEPES, Tris) at pH range 6.0-8.0

These optimizations can significantly improve the yield and activity of recombinant CsbB .

What controls should I include when studying CsbB function?

When studying CsbB function, appropriate controls are essential:

Negative controls:

  • Heat-inactivated CsbB enzyme (95°C for 10 minutes)

  • Reaction without UDP-GlcNAc donor substrate

  • Reaction without undecaprenyl phosphate acceptor substrate

  • Catalytically inactive CsbB mutant (mutate predicted catalytic residues)

Positive controls:

  • Commercial glycosyltransferase with known activity

  • Well-characterized glycosyltransferase from B. subtilis (if available)

Experimental validation controls:

  • Western blot to confirm CsbB expression and stability

  • Complementation of csbB deletion phenotype in B. subtilis

  • Mass spectrometry to confirm product formation

Safety controls for laboratory work:
When conducting experiments with recombinant proteins and bacteria, proper laboratory safety protocols must be followed to prevent accidents. As highlighted in search result , laboratory accidents can occur in academic institutions, resulting in injuries or even fatalities. Always follow institutional safety guidelines, use appropriate personal protective equipment, and be aware of hazards associated with chemicals and equipment used in your experiments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.