Recombinant Bacillus subtilis Putative HMP/thiamine permease protein ykoE (ykoE)

Shipped with Ice Packs
In Stock

Description

Functional Role in Thiamine Transport

The ykoE protein plays a crucial role in the transport of thiamine (vitamin B1) or its precursor hydroxymethylpyrimidine (HMP) across the bacterial cell membrane . Thiamine pyrophosphate, the active form of thiamine, serves as a cofactor for numerous enzymes involved in carbohydrate and amino acid metabolism, making it essential for bacterial survival .

Mutational analysis has experimentally confirmed that the YkoFEDC complex from B. subtilis functions as a transporter for thiamine or its HMP precursor . Interestingly, studies have shown that the presence of HMP specifically influences the expression levels of the ykoFEDC operon but not that of another thiamine transporter (ECF-ThiT), supporting the specialized role of the YkoFEDC complex in HMP transport .

The transport mechanism involves the ykoE component functioning as the substrate-binding S component of the ECF transporter, with tight binding affinity for thiamine. This has been demonstrated in experiments where thiamine could be detected using MALDI-TOF mass spectrometry from denatured YkoE protein, even when the protein was expressed in minimal media without added thiamine . These findings confirm that the affinity between ykoE and thiamine is exceptionally strong, consistent with the protein's role as a high-affinity transporter for scarce nutrients .

The ykoFEDC Operon and Transport Complex

The ykoE gene is part of the ykoFEDC operon in Bacillus subtilis, which encodes a unique thiamine-related ABC transporter . This operon is found primarily in Gram-positive bacteria and is regulated by a THI box riboswitch, implicating the complex in thiamine or thiamine precursor transport across the bacterial membrane .

Components of the ykoFEDC Operon

ComponentFunctionDescription
ykoFSoluble thiamine-binding proteinBinds HMP/thiamine; not essential in all bacterial species
ykoES componentSubstrate-capture component; binds thiamine or HMP
ykoDATPase componentContains two fused ATP-binding domains; provides energy for transport
ykoCT componentTransmembrane component of the ECF transporter

The YkoEDC complex forms a group I ECF transporter, where ykoE acts as the substrate-capture S component, ykoC as the transmembrane T component, and ykoD represents the ABC component consisting of two fused ATPase domains . In B. subtilis, the complex includes the additional ykoF gene, which encodes a soluble thiamine-binding protein .

Structural and biochemical analyses have demonstrated major differences between ykoE and group II ECF transporters, indicating evolutionary divergence of group I vitamin transporter S components from other ECF transporters . This specialized structure allows the transport complex to efficiently capture and import thiamine or its precursors from the external environment, particularly in nutrient-limited conditions.

Biochemical Properties and Experimental Studies

Several experimental studies have characterized the biochemical properties of the ykoE protein, providing insights into its function and binding characteristics. Temperature melting circular dichroism (CD) experiments have been used to assess the stability of ykoE protein expressed under different conditions, investigating potential differences between pre-bound and apo-ykoE forms .

The crystal structure of YkoF, another component of the operon, has revealed that it binds both HMP and thiamine . This binding ability, combined with the transport function of the ykoE component, suggests a coordinated mechanism for thiamine acquisition in B. subtilis.

In silico screening of the B. subtilis genome with the thi box sequence has confirmed that the ykoFEDC operon is regulated by thiamine levels . This regulation mechanism involves TPP (thiamine pyrophosphate) interacting with the nascent mRNA message at a cis-acting site within the 5′ leader region (called the thi box) to form a secondary structure that allows for the formation of a transcription terminator . This riboswitch mechanism directly regulates the expression of thiamine biosynthesis genes in response to intracellular TPP levels, demonstrating how bacteria efficiently control thiamine metabolism.

Genetic Context and Regulation

Genetic studies have provided valuable information about the regulation of the ykoFEDC operon. The operon is regulated by a THI box riboswitch, which responds to intracellular levels of thiamine pyrophosphate (TPP) . When TPP levels are high, the riboswitch adopts a conformation that inhibits transcription or translation of the operon, thereby reducing the expression of the transport proteins .

Interestingly, mutations in the ykoD gene, which encodes the ATPase component of the transporter, have been shown to deregulate thiamine biosynthesis in B. subtilis . This deregulation occurs in combination with mutations in other thiamine-related genes, such as yuaJ (which encodes another thiamine permease) and thiN (which encodes a thiamine pyrophosphokinase) .

The genetic context of the ykoE gene provides additional evidence for its role in thiamine transport. The positional clustering of the ykoEDC genes with tenA, a gene encoding a thiaminase, further supports its involvement in thiamine metabolism .

Research Applications

The recombinant ykoE protein serves several important research applications:

  1. Structural studies to understand membrane transport mechanisms

  2. Functional characterization of bacterial nutrient acquisition systems

  3. Investigation of thiamine metabolism and regulation

  4. Development of potential antimicrobial targets

  5. Comparative studies with other transport systems

Future Research Directions

The study of ykoE and its role in thiamine transport continues to be an active area of research. Future investigations may focus on:

  1. Detailed characterization of the transport mechanism at the molecular level

  2. Elucidation of the exact substrate specificity (thiamine vs. HMP)

  3. Investigation of the protein's potential as an antimicrobial target

  4. Comparative analysis with thiamine transport systems in other bacteria

  5. Application in biotechnology for vitamin production or delivery systems

The recent availability of the crystal structure of ykoE represents a significant advancement in understanding this important transport protein. Further structural and functional studies will likely provide additional insights into the mechanism of thiamine transport and its regulation in bacteria, potentially leading to novel applications in medicine and biotechnology.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
ykoE; BSU13230; Putative HMP/thiamine permease protein YkoE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ykoE
Target Protein Sequence
MKSWKVKEIVIMSVISIVFAVVYLLFTHFGNVLAGMFGPIAYEPIYGIWFIVSVIAAYMI RKPGAALVSEIIAALVECLLGNPSGPMVIVIGIVQGLGAEAVFLATRWKAYSLPVLMLAG MGSSVASFIYDLFVSGYAAYSPGYLLIMLVIRLISGALLAGLLGKAVSDSLAYTGVLNGM ALGKELKKKRKRASEHASL
Uniprot No.

Target Background

Function

Recombinant Bacillus subtilis Putative HMP/thiamine permease protein ykoE (ykoE) is part of the ABC transporter complex YkoCDEF. It transports hydroxymethylpyrimidine (HMP) and/or thiamine, and potentially other HMP-containing compounds. Its primary function is likely the translocation of substrate across the membrane.

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of ykoE in Bacillus subtilis?

YkoE functions as part of a unique thiamin-related ABC transporter system in Bacillus subtilis, consisting of four genes: YkoF, YkoE, YkoD, and YkoC. This transporter system is found in several Gram-positive bacteria, including B. subtilis, and plays a critical role in thiamine uptake and metabolism . The functional relationship between these genes suggests coordinated expression and activity, with YkoF serving as the substrate-binding component while YkoE likely functions as the permease component of this transporter complex. For experimental investigations, researchers should consider the operon structure and potential co-regulation of these genes when designing knockout studies or expression analyses.

How does the structure of YkoE relate to its function as a permease protein?

While the search results don't provide explicit structural details for YkoE itself, we can draw insights from the related YkoF protein. YkoF contains internal repeats of an ACT domain-like fold that binds thiamin molecules . As the permease component of the same transporter system, YkoE likely contains transmembrane domains characteristic of ABC transporter permeases, with specific structural features that facilitate the translocation of HMP/thiamine across the cell membrane. Researchers investigating YkoE structure should consider comparative modeling approaches using other characterized ABC transporter permease proteins, complemented by experimental verification through techniques such as circular dichroism or X-ray crystallography.

What expression systems are most appropriate for recombinant YkoE production?

For recombinant production of YkoE, B. subtilis itself serves as an excellent expression host due to its efficient secretion ability, high protein yield, and non-toxicity . When designing expression systems, researchers should consider:

  • Expression vector selection: Either autonomous plasmid-based systems or chromosomally integrated constructs

  • Promoter optimization: Selection of constitutive or inducible promoters depending on experimental needs

  • Codon optimization: Adjusting codons to match B. subtilis preference for enhanced expression

  • Signal peptide selection: Critical for efficient secretion if extracellular production is desired

The optimization approach should include testing multiple constructs with varying promoter strengths and signal peptides to identify the combination that yields optimal functional YkoE protein .

What are the recommended approaches for purifying recombinant YkoE protein?

Purification of recombinant YkoE requires careful consideration of its membrane-associated nature. A methodological approach should include:

  • Membrane fraction isolation: Differential centrifugation following cell lysis

  • Detergent solubilization: Testing multiple detergents (e.g., DDM, LDAO, Triton X-100) for optimal extraction

  • Affinity chromatography: Using epitope tags (His6, FLAG) for initial purification

  • Size-exclusion chromatography: For final polishing and buffer exchange

When developing a purification protocol, researchers should validate protein folding through functional assays, as membrane proteins often lose activity during extraction. Additionally, consider including stabilizing agents such as glycerol or specific lipids to maintain protein integrity throughout the purification process.

How can yoked control designs be implemented in YkoE functional studies?

Yoked control designs, where matched research subjects receive identical stimuli or conditions , can be adapted for YkoE functional studies to isolate specific variables. For example:

  • Expression comparison: Create paired strains expressing wild-type YkoE and a mutated version under identical promoters and growth conditions

  • Transport assays: Compare thiamine/HMP uptake in yoked strain pairs where one expresses YkoE and the other a control permease

  • Protein interaction studies: Examine binding interactions with paired proteins (YkoE vs. control) against the same potential interaction partners

The key advantage of this approach is the reduction of experimental variability, allowing more sensitive detection of functional differences. For example, when testing substrate specificity, a yoked design would expose both the experimental and control proteins to identical substrate concentrations and environmental conditions, minimizing batch effects .

How does the crystal structure of YkoF inform hypotheses about YkoE function and substrate specificity?

The crystal structure of YkoF reveals important insights that can guide YkoE research. YkoF contains a tandem of ferredoxin-like βαββαβ motifs and binds thiamin molecules with varying affinities . This structure suggests:

  • YkoF specifically recognizes the HMP moiety of thiamin through a unique H-bonding pattern

  • The presence of two binding sites with different affinities indicates potential for regulatory control

For YkoE research, these findings suggest that:

  • YkoE likely contains complementary binding pockets that facilitate thiamin/HMP transport

  • The permease may demonstrate similar substrate specificity for the HMP moiety

  • Structure-guided mutagenesis of YkoE should focus on predicted substrate interaction sites

Researchers should use computational modeling based on the YkoF-thiamin complex data to predict critical residues in YkoE and verify these through site-directed mutagenesis followed by functional transport assays .

What methodological approaches are most effective for studying the interaction between YkoE and other components of the thiamine ABC transporter?

Investigating interactions between YkoE and other components of the thiamine ABC transporter (YkoF, YkoD, YkoC) requires sophisticated methodological approaches:

  • In vivo crosslinking: Use chemical crosslinkers followed by co-immunoprecipitation to capture protein complexes

  • Bacterial two-hybrid systems: Adapted for membrane protein interactions

  • Förster resonance energy transfer (FRET): For detecting proximity between labeled components

  • Native mass spectrometry: To analyze intact membrane protein complexes

For these interactions, researchers should design experiments that account for the membrane environment. Consider reconstituting the purified components in liposomes or nanodiscs to mimic the native membrane environment. Additionally, researchers can employ genetic approaches such as suppressor mutation analysis to identify functional interactions indirectly .

How can surface engineering approaches be applied to improve crystal formation for structural studies of YkoE?

The crystallization of membrane proteins like YkoE presents significant challenges. Drawing from the successful crystallization of YkoF through surface engineering , researchers can apply similar strategies:

  • Surface conformational entropy reduction: Identify and mutate surface residues with high conformational entropy (typically lysines and glutamates) to alanines

  • Systematic mutation screening: Create multiple surface mutants (e.g., K33A/K34A, K112A/E114A as done for YkoF)

  • Crystallization condition optimization: Test divalent ions (particularly Ca²⁺) that may facilitate crystal contacts

This approach was successful for YkoF, where the K33A/K34A double mutant readily crystallized in the presence of Ca²⁺ ions, which formed an intermolecular binding site essential for crystal lattice formation . For YkoE, researchers should first create a computational model to identify surface-exposed residues with high conformational entropy, design multiple mutant combinations, and screen these against various crystallization conditions.

What strategies can address the challenges of expressing membrane proteins like YkoE in recombinant systems?

Expressing membrane proteins presents unique challenges. For YkoE expression, researchers should consider:

  • Toxicity mitigation: Use tightly regulated expression systems with inducible promoters to prevent cellular toxicity

  • Membrane stress management: Co-express chaperones specific to membrane proteins

  • Host strain optimization: Use B. subtilis strains with reduced protease activity to improve yield

  • Integration vs. plasmid expression: Compare chromosomal integration with plasmid-based expression to determine optimal stability and yield

Additionally, researchers can implement a dual-phase expression strategy, where cells are first grown to high density before induction at reduced temperature, minimizing toxic effects while maximizing yield. Monitoring membrane integrity during expression is critical to ensure the recombinant protein doesn't compromise cellular viability .

How can researchers accurately assess the functional activity of recombinant YkoE?

Functional characterization of YkoE requires multiple complementary approaches:

  • Transport assays: Measure uptake of radiolabeled or fluorescently labeled thiamine/HMP

  • Growth complementation: Test whether recombinant YkoE restores growth in thiamine transport-deficient strains

  • ATPase activity assays: Measure ATP hydrolysis in reconstituted systems with YkoE and the ATPase component (YkoD)

  • Ligand binding studies: Use microscale thermophoresis or isothermal titration calorimetry to determine binding parameters

When designing functional assays, researchers should include appropriate controls:

  • Catalytically inactive mutants (e.g., mutating predicted essential residues)

  • Alternative substrate specificity controls

  • Complete transporter complex vs. individual components

Validation across multiple assay types provides stronger evidence for functional activity than any single approach .

What approaches are recommended for analyzing conflicting data in YkoE research?

When faced with conflicting data in YkoE research, implement a systematic troubleshooting approach:

  • Methodological validation: Verify all experimental protocols using positive and negative controls

  • Cross-technique verification: Confirm findings using independent methodological approaches

  • Strain background effects: Test whether genetic background influences results

  • Environmental variables: Examine whether media composition, growth phase, or other conditions affect outcomes

For example, if transport assays and binding studies yield contradictory results regarding substrate specificity, researchers should:

  • Verify protein folding and membrane insertion

  • Examine whether transport requires additional cofactors

  • Consider kinetic vs. thermodynamic parameters that might explain the discrepancy

Document all experimental variables meticulously, as subtle differences in protocols can significantly impact results with membrane proteins like YkoE.

How should researchers approach the integration of structural and functional data for YkoE?

Integrating structural and functional data requires a methodical approach:

  • Structure-function mapping: Correlate structural predictions with functional outcomes

  • Iterative modeling: Refine structural models based on functional data

  • Molecular dynamics simulations: Use computational approaches to model dynamic aspects not captured in static structures

  • Evolutionary analysis: Compare YkoE sequences across species to identify conserved features likely crucial for function

When analyzing integrated data, consider creating a comprehensive database that links:

  • Mutated residues

  • Structural context of mutations

  • Functional impact across multiple assays

  • Evolutionary conservation scores

This integrated approach allows researchers to distinguish between structural defects (affecting protein folding or stability) and specific functional impairments (affecting substrate binding or translocation) .

How can YkoE research contribute to understanding broader ABC transporter mechanisms?

YkoE research offers valuable insights into ABC transporter mechanisms:

  • Substrate specificity determinants: Understanding how YkoE recognizes thiamine/HMP can reveal general principles of substrate selection

  • Coupling mechanisms: Elucidating how substrate binding by YkoF triggers conformational changes in YkoE provides insights into signal transduction in ABC transporters

  • Energy coupling: Determining how ATP hydrolysis by YkoD drives substrate translocation through YkoE informs broader bioenergetic principles

Research approaches should include comparative studies with other ABC transporters, focusing on conserved motifs and divergent regions that might explain functional specialization. Additionally, researchers can use chimeric constructs, swapping domains between YkoE and other permeases to identify elements responsible for specific functions .

What are the most promising future research directions for ykoE studies?

Based on current knowledge, several promising research directions emerge:

  • Regulatory networks: Investigate how ykoE expression responds to thiamine availability and other metabolic signals

  • Structural dynamics: Employ cryo-EM or DEER spectroscopy to capture different conformational states during the transport cycle

  • Synthetic biology applications: Engineer YkoE variants with altered substrate specificity for biotechnological applications

  • Systems biology integration: Examine how YkoE function influences broader cellular metabolism and adaptation

Researchers should consider developing high-throughput screening methods to identify small molecule modulators of YkoE activity, which could serve as tools for dissecting transport mechanisms and potentially as leads for therapeutic development targeting related transporters in pathogenic bacteria .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.