Recombinant Bacillus subtilis Putative lipid phosphate phosphatase yodM (yodM)

Shipped with Ice Packs
In Stock

Description

Introduction to YodM Phosphatase

The yodM gene of Bacillus subtilis encodes a membrane-bound protein belonging to the phosphatidic acid phosphatase type 2 (PAP2) family. Through extensive biochemical characterization and in vivo functional experiments, researchers have identified YodM as the principal phosphatidylglycerol phosphate (PGP) phosphatase in B. subtilis, leading to its alternative designation as bsPgpB . The enzyme plays a crucial role in phospholipid metabolism, particularly in the biosynthesis of phosphatidylglycerol, a major component of bacterial membranes. Additionally, YodM exhibits weaker activity toward undecaprenyl pyrophosphate (C55-PP), indicating a secondary role in cell wall biosynthesis pathways .

The recombinant expression and purification of YodM have enabled detailed structural and functional analyses, providing significant insights into substrate specificity determinants and catalytic mechanisms. These studies have established YodM as an important model for understanding membrane-bound phosphatases and their roles in bacterial physiology.

Crystal Structure Analysis

The crystal structure of YodM (bsPgpB) has been solved at 2.25 Å resolution, providing valuable insights into its three-dimensional organization and catalytic mechanism. The structural analysis revealed the presence of tungstate (a phosphate analog) in the active site, offering important clues about the enzyme's catalytic properties . Notably, the structure shows two lipid chains in the vicinity of the active site, which has enabled computational modeling of substrate interactions and molecular dynamics simulations to understand enzyme function.

Active Site Architecture and Substrate Binding

The active site of YodM exhibits specific structural features that determine its substrate preference for phosphatidylglycerol phosphate over undecaprenyl pyrophosphate. Site-directed mutagenesis studies based on the crystal structure have confirmed the importance of specific residues for substrate recognition and catalysis, providing a molecular basis for predicting the lipid substrates preferentially dephosphorylated by membrane PAP2 enzymes . This structural information has been instrumental in understanding how YodM accommodates its preferred substrate and facilitates the dephosphorylation reaction.

Phospholipid Metabolism

The primary physiological function of YodM in B. subtilis appears to be in phospholipid metabolism, specifically as the principal phosphatidylglycerol phosphate (PGP) phosphatase. This enzymatic activity is crucial for the biosynthesis of phosphatidylglycerol, a major component of bacterial cell membranes. Experimental evidence indicates that YodM contributes approximately 70% of the total PGP phosphatase activity present in B. subtilis membranes, highlighting its significance in phospholipid homeostasis .

Gene Deletion and Overexpression Effects

Experimental studies involving yodM deletion and overexpression have provided valuable insights into its physiological significance. A B. subtilis strain with the chromosomal copy of yodM deleted (designated as BS502) displayed the same growth phenotype in both rich and minimal media as the parental strain, indicating that YodM is not essential for bacterial growth under standard laboratory conditions . Furthermore, the deletion mutant did not show increased susceptibility to bacitracin, an antibiotic that targets undecaprenyl pyrophosphate, unlike strains lacking other undecaprenyl pyrophosphate phosphatases such as BcrC .

Enzymatic Activity Measurements

Detailed biochemical analyses have quantified the enzymatic activities of YodM toward different substrates. The measurements of C55-PP and PGP phosphatase activities in membrane protein extracts from various B. subtilis strains (wild-type, ΔyodM mutant, and yodM-overexpressing strains) have provided compelling evidence for YodM's substrate preference. The data are summarized in Table 1, which shows the specific and relative activities for these substrates across different strains.

Table 1. C55-PP and PGP Phosphatase Activities in Different Bacillus subtilis Strains

StrainC55-PPPGP
Specific activity (nmol/min/mg)Relative activitySpecific activity (nmol/min/mg)Relative activity
B. subtilis 1681.06 ± 0.1810.84 ± 0.121
B. subtilis overexpressing yodM (BS525)22.0 ± 2.220275.6 ± 67.6328
B. subtilis ΔyodM (BS502)1.22 ± 0.121.10.24 ± 0.040.29

As shown in Table 1, deletion of yodM resulted in a minimal change in C55-PP phosphatase activity (1.1-fold relative to wild-type) but caused a significant 3.5-fold decrease in PGP phosphatase activity . Conversely, overexpression of yodM led to a 20-fold increase in C55-PP phosphatase activity and a dramatic 328-fold increase in PGP phosphatase activity compared to the wild-type strain . These results clearly demonstrate that YodM has a strong preference for PGP as a substrate while exhibiting significantly weaker activity toward C55-PP.

Relative Contributions to Lipid Carrier Recycling

In the context of cell wall biosynthesis in B. subtilis, YodM functions alongside other undecaprenyl pyrophosphate phosphatases, particularly BcrC and UppP. Studies have shown that while YodM does possess C55-PP phosphatase activity, its contribution to lipid carrier recycling is minimal compared to these other enzymes. Specifically, BcrC appears to be the dominant phosphatase in this pathway, with its deletion leading to a stronger reduction in resistance against bacitracin than the deletion of UppP . YodM plays an even more minor role in this process, consistent with its primarily functioning as a PGP phosphatase.

Substrate Specificity Determinants

The substrate specificity of YodM, favoring PGP over C55-PP, distinguishes it from other phosphatases in B. subtilis. This preference appears to be determined by specific structural features of the enzyme, particularly residues in the active site vicinity that interact with the substrate. Site-directed mutagenesis studies based on the crystal structure have identified key residues that influence substrate recognition and catalysis . Understanding these determinants of substrate specificity provides valuable insights into the functional specialization of different phosphatases in bacterial membranes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
pgpB; yodM; BSU19650; Phosphatidylglycerophosphatase B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-203
Protein Length
Full Length of Mature Protein
Species
Bacillus subtilis (strain 168)
Target Names
pgpB
Target Protein Sequence
DEAISKAAVLIRQPWLNEVMTGITHLGASSFLLPLIVIIGAGMFFYRKTWDGLLMLLVFG TDRLLNKVLKEWIERVRPDFAPLVHESSFSFPSGHSMNAACVYPVIAYFLVKHLPFLSKH KKMVYIIAGVIAVLVGISRVYLGVHFVTDVLGGFSLGLLLFFLVKGFDEKIKRFRQK
Uniprot No.

Target Background

Function
This protein catalyzes the dephosphorylation of phosphatidylglycerophosphate (PGP) to phosphatidylglycerol. It also exhibits undecaprenyl pyrophosphate phosphatase activity, essential for the biosynthesis of the lipid carrier undecaprenyl phosphate.
Database Links
Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted function of YodM in Bacillus subtilis?

YodM is classified as a putative lipid phosphate phosphatase in Bacillus subtilis, suggesting its primary function involves the dephosphorylation of phospholipid substrates. As a member of the phosphatase enzyme family, YodM likely participates in membrane phospholipid metabolism or signaling pathways. B. subtilis utilizes various regulatory proteins to maintain cell envelope integrity, with phosphatases playing critical roles in these processes. While specific YodM activity characterization remains ongoing, its classification suggests involvement in cellular processes similar to other characterized phosphatases in this model organism .

What experimental methods can confirm YodM's phosphatase activity?

To confirm YodM's phosphatase activity, researchers should employ multiple complementary approaches:

  • In vitro phosphatase assays: The malachite green-based assay represents an excellent method for detecting phosphate release from potential substrates. This colorimetric assay measures inorganic phosphate released through enzyme activity .

  • Substrate specificity testing: Testing various phospholipid substrates to determine YodM's preference and catalytic efficiency. Standard reaction conditions would include:

    • 33 μl H₂O

    • 10 μl 5X assay buffer at optimal pH

    • 1 μl 100 mM DTT

    • Substrate (various concentrations)

    • Purified recombinant YodM

  • Kinetic characterization: Determining enzyme parameters (Km, Vmax, kcat) using increasing substrate concentrations and fixed enzyme amounts.

  • Inhibitor studies: Testing known phosphatase inhibitors to classify YodM's mechanism.

Results should be quantified using spectrophotometric measurements at appropriate wavelengths (e.g., 620 nm for malachite green assays) .

What are the optimal conditions for expressing recombinant YodM in heterologous systems?

The optimal expression conditions for recombinant YodM production would typically involve:

  • Expression system selection: E. coli BL21(DE3) or similar strains designed for recombinant protein expression represent standard choices for initial expression trials.

  • Vector optimization:

    • Incorporation of appropriate affinity tags (His6, GST) for purification

    • Selection of promoters (T7, tac) for controlled expression

    • Codon optimization for the expression host

  • Induction parameters:

    • Temperature: Testing 16°C, 25°C, and 37°C during induction

    • Inducer concentration: Titrating IPTG (0.1-1.0 mM)

    • Induction duration: Testing 4h, 8h, and overnight expression

  • Solubility enhancement:

    • Addition of solubility-enhancing tags (MBP, SUMO)

    • Co-expression with chaperones

    • Testing various lysis buffers with stabilizing agents

Optimization requires systematic testing of these parameters, monitoring expression levels via SDS-PAGE, and assessing protein functionality through activity assays .

What is the most effective method for assessing YodM phosphatase activity against lipid substrates?

The most effective method for assessing YodM phosphatase activity against lipid substrates involves a multi-component approach:

  • Malachite green phosphate detection assay: This provides quantitative measurement of phosphate release from lipid substrates. The protocol should include:

    • Reaction buffer: 100 mM sodium acetate, 50 mM Bis-Tris, 50 mM Tris at optimal pH

    • DTT: 1-2 mM final concentration

    • Substrate preparation: Solubilized lipid substrates

    • Reaction termination: 0.1M N-ethylmaleimide for thiol-containing enzymes

    • Detection: Malachite green reagent with 40-minute incubation

    • Quantification: Absorbance at 620 nm against a phosphate standard curve

  • Thin-layer chromatography (TLC): For visual confirmation of lipid substrate modification

  • Mass spectrometry: For definitive identification of reaction products

  • Controls:

    • Heat-inactivated enzyme

    • Known phosphatases with confirmed activity

    • Substrate-only reactions

A comprehensive experimental design would include testing various lipid substrates at different concentrations and time points to establish substrate preference and kinetic parameters.

How can I develop a reliable assay to measure YodM activity in cell lysates?

Developing a reliable assay for measuring YodM activity in cell lysates requires addressing several technical challenges:

  • Lysate preparation optimization:

    • Buffer composition: 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 1 mM DTT, with protease inhibitors

    • Cell disruption method: Sonication or French press for B. subtilis

    • Clarification: High-speed centrifugation (20,000 × g, 30 min)

  • Background phosphatase activity control:

    • Comparative analysis between wild-type and YodM knockout lysates

    • Use of selective inhibitors for different phosphatase classes

    • Immunodepletion of YodM using specific antibodies

  • Assay sensitivity enhancement:

    • Substrate selection: Using fluorescent or radioactive phospholipid substrates

    • Signal amplification: Coupling to secondary enzyme reactions

    • Optimal reaction conditions: Testing various pH values, temperatures, and ionic strengths

  • Validation approach:

    • Correlation between recombinant YodM concentration and activity signal

    • Specificity testing using known phosphatase inhibitors

    • Reproducibility assessment across multiple lysate preparations

The malachite green assay can be adapted for lysate analysis, with additional controls to account for background phosphate and phosphatase activity .

How does YodM contribute to B. subtilis cell envelope maintenance?

YodM likely contributes to B. subtilis cell envelope maintenance through phospholipid metabolism regulation, though specific mechanisms remain to be fully characterized. Based on functional similarities to other phosphatases, potential contributions include:

  • Membrane phospholipid turnover: Dephosphorylation of specific phospholipids, potentially modifying membrane fluidity or charge distribution.

  • Cell envelope stress response: Possible involvement in signaling pathways that respond to envelope stress, similar to other regulatory proteins in B. subtilis.

  • Peptidoglycan synthesis regulation: Indirect influence on cell wall synthesis through interactions with membrane-associated proteins involved in peptidoglycan biosynthesis .

  • Sporulation-associated membrane remodeling: Potential role during sporulation, when significant membrane restructuring occurs, similar to YodL and YisK which have been shown to affect cellular morphology during sporulation .

Research approaches to elucidate these functions should include phenotypic analysis of yodM deletion mutants, microscopic examination of membrane structure, and phospholipid profiling under various growth conditions.

What is the relationship between YodM and bacterial cell shape determination?

While direct evidence linking YodM to cell shape determination is limited, its classification as a phosphatase suggests potential indirect roles in this process:

  • Potential interactions with cytoskeletal proteins: By analogy with YodL and YisK, which modulate MreB and Mbl activity (actin-like proteins essential for cell shape), YodM might influence cell shape through similar mechanisms .

  • Peptidoglycan synthesis influence: Phosphatases can regulate the activity of proteins involved in peptidoglycan synthesis, which directly impacts cell morphology. As MreB and MreB-like proteins guide peptidoglycan synthesis during cell elongation, YodM might indirectly affect this process .

  • Membrane composition effects: By modifying phospholipid composition, YodM could affect membrane properties that influence cell shape.

Experimental approaches to investigate this relationship should include:

  • Microscopic analysis of cell morphology in YodM overexpression and deletion strains

  • Colocalization studies with cell shape determinants

  • Genetic interaction studies with mreB, mbl, and other morphogenic genes

Is YodM activity regulated during different growth phases or stress conditions?

The regulation of YodM activity during different growth phases or stress conditions likely follows patterns similar to other B. subtilis proteins involved in cell envelope processes:

  • Transcriptional regulation: YodM expression may be controlled by growth phase-specific sigma factors or stress-responsive transcription factors. By analogy with YodL and YisK, which are regulated by Spo0A (a master regulator of sporulation), YodM might be similarly regulated during specific developmental stages .

  • Post-translational modifications: Phosphatase activity can be regulated through phosphorylation, oxidation of catalytic cysteine residues, or protein-protein interactions.

  • Metabolic regulation: Substrate availability or product feedback inhibition may regulate YodM activity in response to metabolic changes.

Research approaches should include:

  • Transcriptomic analysis across growth phases and stress conditions

  • Reporter fusion studies to monitor promoter activity

  • Activity assays under various physiological conditions

  • Phosphoproteomics to identify potential regulatory modifications

This regulation is critical as B. subtilis adapts to diverse environments, reflecting the bacterium's sophisticated regulatory network that maintains metabolic homeostasis .

How does YodM potentially interact with other phosphatases in B. subtilis?

YodM likely participates in a functional network with other phosphatases in B. subtilis, creating a coordinated system for regulating phosphorylation states. Potential interaction mechanisms include:

  • Substrate channeling: Sequential action on specific phospholipid substrates, with different phosphatases removing phosphate groups from distinct positions.

  • Regulatory interactions: Direct protein-protein interactions that modify catalytic activity, similar to regulatory mechanisms observed in other phosphatase systems.

  • Compensatory mechanisms: Functional redundancy where multiple phosphatases share overlapping substrates, ensuring robust cellular function even when individual enzymes are compromised.

  • Spatial organization: Co-localization in specific subcellular compartments to ensure coordinated activity on membrane substrates.

Experimental approaches to investigate these interactions should include:

  • Co-immunoprecipitation studies

  • Bacterial two-hybrid assays

  • Double/triple knockout phenotypic analysis

  • Fluorescence resonance energy transfer (FRET) to detect direct interactions

  • Lipidomics analysis in various phosphatase mutant backgrounds

These studies would reveal functional relationships between YodM and other phosphatases, providing insight into the integrated phospholipid regulation system.

What evidence exists for YodM involvement in signaling pathways?

Direct evidence for YodM involvement in signaling pathways is currently limited, but several lines of investigation could reveal such connections:

  • Phospholipid signaling: As a putative lipid phosphate phosphatase, YodM likely modifies signaling phospholipids, potentially affecting:

    • Membrane-derived second messengers

    • Lipid raft formation and organization

    • Membrane protein localization and activity

  • Sporulation signaling: By analogy with YodL and YisK, which affect sporulation efficiency when deleted, YodM might participate in sporulation signaling pathways, potentially through Spo0A-regulated processes .

  • Stress response signaling: Phosphatases often regulate stress response pathways through dephosphorylation of key signaling proteins.

Experimental approaches to investigate signaling involvement should include:

  • Phosphoproteomic analysis comparing wild-type and yodM mutant strains

  • Epistasis analysis with known signaling pathway components

  • Phenotypic characterization under various stress conditions

  • Measurement of second messenger levels in yodM mutant backgrounds

These investigations would help position YodM within the complex signaling networks that enable B. subtilis to respond to environmental changes.

What methodological approaches can resolve contradictory findings about YodM function?

Resolving contradictory findings about YodM function requires systematic methodological approaches:

  • Standardization of experimental conditions:

    • Define precise growth conditions (media composition, temperature, aeration)

    • Standardize protein purification protocols

    • Establish uniform activity assay conditions

    • Create reference datasets with positive and negative controls

  • Comparative analysis using multiple techniques:

    • Enzymatic assays using different detection methods

    • In vivo vs. in vitro activity comparison

    • Genetic approaches (deletion, complementation, point mutations)

    • Structural biology methods to correlate structure with function

  • Advanced data integration approaches:

    • Meta-analysis of published datasets

    • Statistical modeling to identify variables affecting outcomes

    • Machine learning to identify patterns in complex datasets

    • Systems biology approaches integrating multiple data types

  • Collaborative cross-laboratory validation:

    • Multi-laboratory testing of key findings

    • Round-robin experiments with standardized materials

    • Development of consensus protocols

How can CRISPR-Cas9 genome editing be optimized for studying YodM in B. subtilis?

Optimizing CRISPR-Cas9 genome editing for studying YodM in B. subtilis requires addressing several technical considerations:

  • Guide RNA design optimization:

    • Selection of target sites with minimal off-target effects

    • Testing multiple gRNAs targeting different regions of the yodM gene

    • Incorporation of appropriate promoters for gRNA expression in B. subtilis

  • Delivery system refinement:

    • Development of optimized transformation protocols for B. subtilis

    • Construction of shuttle vectors with appropriate origin of replication

    • Inducible expression systems for temporal control of Cas9 expression

  • Repair template strategies:

    • Homology arm length optimization (typically 500-1000 bp)

    • Incorporation of silent mutations to prevent re-cutting

    • Design of precise modifications (point mutations, tags, reporters)

  • Screening and validation methods:

    • Colony PCR protocols for rapid screening

    • Restriction digest strategies for mutation detection

    • Sequencing confirmation of genomic modifications

    • Functional validation of mutant phenotypes

This optimized approach would enable precise genetic manipulation of YodM, including:

  • Single amino acid substitutions to identify catalytic residues

  • Domain swapping experiments

  • Addition of epitope tags for localization and interaction studies

  • Creation of conditional expression systems

What are the most promising approaches for developing selective inhibitors of YodM activity?

Developing selective inhibitors of YodM activity requires a multi-faceted drug discovery approach:

  • Structure-based design strategy:

    • Determination of YodM crystal structure through X-ray crystallography

    • In silico docking studies with virtual compound libraries

    • Molecular dynamics simulations to identify binding pocket flexibility

    • Fragment-based screening to identify starting scaffolds

  • High-throughput screening approach:

    • Development of miniaturized activity assays suitable for 384/1536-well formats

    • Primary screening of diverse chemical libraries

    • Counter-screening against other phosphatases to identify selective hits

    • Structure-activity relationship studies on promising scaffolds

  • Rational design based on substrate mimicry:

    • Synthesis of non-hydrolyzable substrate analogs

    • Phosphonate-based competitive inhibitors

    • Transition state mimetics

  • Validation and optimization pipeline:

    • Biochemical validation of hit compounds

    • Cellular activity assessment in B. subtilis

    • Physicochemical property optimization

    • Selectivity profiling against related phosphatases

This approach would yield chemical probes for studying YodM function in vivo and potentially lead to novel antimicrobial strategies targeting specific bacterial phosphatases.

What is the evolutionary relationship between YodM and phosphatases in other bacterial species?

Understanding the evolutionary relationship between YodM and phosphatases in other bacterial species requires comprehensive phylogenetic analysis:

  • Sequence-based phylogenetic analysis:

    • Multiple sequence alignment of YodM homologs across diverse bacterial phyla

    • Construction of phylogenetic trees using maximum likelihood methods

    • Identification of conserved catalytic motifs and diversification patterns

    • Analysis of selection pressures on different protein domains

  • Structural comparison approach:

    • Structural alignment of available phosphatase crystal structures

    • Prediction of ancestral protein structures

    • Mapping of functional diversification onto structural changes

  • Genomic context analysis:

    • Examination of gene neighborhood conservation

    • Identification of co-evolved gene clusters

    • Analysis of horizontal gene transfer events

  • Functional divergence assessment:

    • Comparative biochemical characterization of diverse homologs

    • Complementation studies in heterologous hosts

    • Identification of species-specific substrate preferences

This evolutionary perspective would reveal how YodM function has been conserved or repurposed across bacterial species, providing insight into the fundamental roles of phosphatases in bacterial physiology and the potential for targeting these enzymes for antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.