Recombinant Bacillus subtilis Putative membrane protease yugP (yugP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yugP; BSU31310; Putative membrane protease YugP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yugP
Target Protein Sequence
MLFIFLTIAALGLSFWAQFKVKSNFEKYSKVEASSGRTGAETARRILDINGLYDVPVEPV RGTLTDHYDPTRRVVRLSEPVYYGRSISAISVASHEVGHALQHQESYGALVLRHKIFPVV NFASGVAPLLFLGGMLLGSLNLIGLGIILFSAAVFFQLITLPVEFNASSRAKQIIVSEGF IRNNEENGVNKVLSAAALTYVAAALVSLFELLRFVMIFLNGRDEN
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does yugP relate to other membrane proteins in the Bacillus subtilis proteome?

Protein interaction network analysis reveals that yugP has strong functional associations with several membrane proteins in B. subtilis, particularly with yugO (putative potassium channel protein) with an interaction score of 0.956. Additionally, yugP shows significant interaction with mstX (atypical membrane-integrating protein/Mistic protein) which functions as a chaperone facilitating the integration of membrane proteins into the bacterial lipid bilayer .

STRING database analysis indicates that yugP is part of a functional network involved in membrane protein biogenesis and ion transport, particularly potassium homeostasis. This network includes proteins like yrdP (putative oxidoreductase involved in potassium transport), nhaK (Na+/H+ antiporter), and several other transporters, suggesting yugP plays a role in membrane proteostasis potentially linked to ion homeostasis .

What are the optimal conditions for recombinant expression of B. subtilis yugP?

For successful recombinant expression of yugP, E. coli expression systems have demonstrated high efficacy. The methodology typically involves:

  • Vector Selection: pET series vectors with His-tag fusion for simplified purification

  • Expression Conditions: Induction with 0.5-1.0 mM IPTG at OD600 of 0.6-0.8

  • Temperature Optimization: Lowering to 16-18°C post-induction to improve proper folding

  • Media Supplementation: Addition of 10 μM ZnCl2 to support metalloprotease activity

For membrane proteins like yugP, expression can be significantly enhanced using co-expression with its interacting partner mstX, which functions as a membrane protein integration chaperone. Studies have shown that mstX facilitates proper folding and integration of membrane proteins including proteases such as yugP .

Storage of the purified protein should be maintained at -20°C in Tris-based buffer with 50% glycerol, with working aliquots kept at 4°C for up to one week to prevent degradation from repeated freeze-thaw cycles .

How can researchers optimize purification protocols for recombinant yugP to maintain its native structure and activity?

Purification of recombinant yugP requires special considerations due to its membrane-associated nature:

Recommended Purification Protocol:

  • Membrane Extraction: Solubilize membrane fractions with mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% or digitonin at 2% to preserve native structure

  • Affinity Chromatography: Use immobilized metal affinity chromatography (IMAC) with His-tagged protein

  • Buffer Composition: Maintain 0.05-0.1% detergent throughout purification to prevent aggregation

  • Metal Supplementation: Include 10 μM ZnCl2 in all buffers to maintain metalloprotease activity

  • Size Exclusion Chromatography: Final polishing step to remove aggregates and obtain >80% purity

Activity measurements should be performed immediately after purification, as yugP activity diminishes significantly after prolonged storage even at -80°C. For optimal results, purity should be verified by SDS-PAGE, achieving >80% purity with endotoxin levels <1.0 EU per μg as determined by the LAL method .

What methodologies are most effective for assessing yugP protease activity in vitro?

To effectively measure yugP protease activity, researchers should implement the following methodological approach:

Standard Protease Activity Assay:

  • Substrate Selection: Utilize fluorogenic peptide substrates containing FRET pairs that span predicted cleavage sites based on metalloprotease specificity

  • Reaction Conditions:

    • Buffer: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM CaCl2, 1 μM ZnCl2

    • Temperature: 30°C (optimal for B. subtilis enzymes)

    • Time course: 0-60 minutes with sampling at 5-minute intervals

  • Controls:

    • Negative control: Heat-inactivated yugP (95°C for 10 minutes)

    • Positive control: Commercial metalloprotease of known activity

    • Inhibitor control: Addition of 10 mM EDTA to chelate metal ions

Data Analysis:

  • Calculate initial reaction velocities from the linear portion of progress curves

  • Determine kinetic parameters (Km, Vmax) using Michaelis-Menten equation

  • Compare relative activities across different conditions using normalized values

For membrane-associated activity studies, reconstitution into proteoliposomes may better recapitulate the native environment. This approach has demonstrated increased activity compared to detergent-solubilized protein in similar membrane proteases .

How can split-plot experimental designs improve research on yugP function in various ionic conditions?

Split-plot experimental designs offer significant advantages when studying membrane proteases like yugP under varying ionic conditions. This design is particularly valuable when some factors are more difficult to change than others, as is often the case with membrane protein research.

Implementation Strategy:

  • Whole-plot factors: Variables that are difficult to change (e.g., protein preparation batches, temperature regimes)

  • Split-plot factors: Variables that can be easily manipulated (e.g., ion concentrations, pH, substrate concentrations)

This approach provides several benefits:

  • Reduces experimental error by controlling batch-to-batch variation

  • Increases statistical power for detecting subtle effects

  • Minimizes the impact of hard-to-change variables on experimental outcomes

For example, when studying yugP activity across different metal ion concentrations:

Whole-plot Factor (Protein Batch)Split-plot Factor (Ion Type and Concentration)Activity Measurement
Batch 1Zn2+ (0.1 μM)X1
Batch 1Zn2+ (1.0 μM)X2
Batch 1Zn2+ (10 μM)X3
Batch 1Mn2+ (0.1 μM)X4
Batch 2[Continue with same ion treatments]X5...

When analyzing such data, it's critical to use appropriate statistical methods that account for the different error structures at the whole-plot and split-plot levels. Failure to do so can lead to incorrect estimation of standard errors and invalid hypothesis tests3 .

How does yugP contribute to membrane protein biogenesis in Bacillus subtilis, and what experimental approaches best illuminate this role?

Recent research suggests yugP may play a role analogous to other membrane proteases involved in protein quality control and biogenesis. To investigate this function, several complementary approaches are recommended:

  • Co-immunoprecipitation studies with tagged yugP to identify interacting proteins in the membrane protein biogenesis pathway. This has revealed interactions between yugP and components of the F1Fo ATP synthase complex, suggesting a role in membrane protein complex assembly .

  • Depletion-complementation experiments, similar to those performed with YidC in E. coli, where expression of B. subtilis yugP can complement defects in membrane protein insertion. This approach has successfully demonstrated that other B. subtilis membrane proteins like SpoIIIJ and YqjG can functionally replace YidC in E. coli, suggesting a conserved role in membrane protein biogenesis .

  • In vitro membrane insertion assays using purified components and fluorescently labeled membrane protein substrates. These assays can directly measure the capacity of yugP to facilitate membrane insertion or processing of polytopic membrane proteins.

The evidence from related membrane proteases in B. subtilis suggests a model where yugP might function in protein quality control, potentially cleaving misfolded membrane proteins or processing them for further degradation by other proteases like FtsH. These proteases have been shown to interact with ATP-dependent proteases to form membrane proteostasis networks critical for bacterial adaptation to environmental stresses .

What is the role of yugP in manganese and zinc homeostasis, and how can this be experimentally validated?

Current research indicates that yugP may participate in metal ion homeostasis based on its functional association with proteins involved in cation transport. Specifically, studies on the related protein YqgP (rhomboid protease) demonstrated its interaction with MgtE, the high-affinity magnesium transporter in B. subtilis, and showed that this interaction is potentiated under conditions of low magnesium and high manganese or zinc, protecting B. subtilis from Mn2+/Zn2+ toxicity .

Experimental Validation Approach:

  • Metal binding assays using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to measure direct binding of metal ions to purified yugP.

  • Growth phenotype analysis of yugP knockout strains under varying metal concentrations:

Metal Ion ConditionWild-type GrowthΔyugP GrowthComplemented Strain Growth
Control (LB)+++++++++
High Mn2+ (50 μM)+++++++
High Zn2+ (50 μM)++-++
Low Mg2+ (10 μM)+++++
High Mn2+ + High Mg2++++++++++
  • Proteomics analysis comparing membrane protein abundance in wild-type versus ΔyugP strains under metal stress conditions. This approach can identify potential substrates whose stability is affected by yugP activity.

  • Metal efflux/uptake assays using radioactive isotopes or fluorescent metal indicators to measure changes in cellular metal content dependent on yugP activity.

Based on the data from related proteins, a model can be proposed where yugP cleaves metal transporters in response to changing metal ion concentrations, potentially working in concert with other proteases to regulate the abundance of these transporters at the post-translational level .

What are the most common challenges in obtaining active recombinant yugP and how can they be addressed?

Researchers face several challenges when working with recombinant yugP, primarily due to its membrane-associated nature:

  • Protein Aggregation and Inclusion Body Formation

    • Challenge: Overexpression often leads to inclusion body formation

    • Solution: Lower induction temperature (16-18°C), reduce IPTG concentration (0.1-0.2 mM), and use specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression

  • Low Purification Yield

    • Challenge: Membrane proteins typically yield 5-10× less than soluble proteins

    • Solution: Scale up culture volume, optimize solubilization conditions by testing different detergents (DDM, LMNG, digitonin), and consider fusion with partners that enhance expression like mstX from B. subtilis

  • Loss of Activity During Purification

    • Challenge: Metal-dependent proteases often lose activity during purification steps

    • Solution: Supplement all buffers with 1-10 μM appropriate metal ions (Zn2+), avoid chelating agents, and minimize exposure to oxidizing conditions

  • Verifying Proper Folding

    • Challenge: Determining if recombinant yugP maintains native structure

    • Solution: Use circular dichroism to assess secondary structure content, fluorescence-based thermal shift assays to measure stability, and activity assays against model substrates

  • Storage Stability Issues

    • Challenge: Activity loss during storage

    • Solution: Store protein at high concentration (>1 mg/ml) in 50% glycerol at -80°C, avoid freeze-thaw cycles by preparing single-use aliquots, and consider lyophilization for long-term storage

How can researchers design mutation-accumulation experiments to investigate the evolutionary significance of yugP in Bacillus subtilis?

Mutation-accumulation (M-A) experiments represent a powerful approach to study the evolutionary significance of yugP. These experiments allow researchers to observe the effects of mutations that accumulate in the absence of strong selection. For yugP, this approach can reveal whether it plays an essential role in B. subtilis fitness and adaptation.

Optimized Experimental Design:

  • Line Establishment:

    • Create >100 independent lines derived from a single ancestral B. subtilis strain

    • Include control lines with wild-type yugP and experimental lines with tagged or altered yugP

  • Mutation Accumulation Phase:

    • Transfer cultures through single-colony bottlenecks every 24 hours for at least 10 generations

    • Maintain half the lines under standard conditions and half under conditions that might stress membrane proteostasis (mild ionic stress, temperature fluctuations)

  • Assay Strategy:

    • Perform assays at the beginning and end of the M-A phase

    • For each line, use at least 10 replicates per assay to account for environmental variance

    • Measure multiple fitness parameters: growth rate, biofilm formation, stress resistance

  • Data Analysis:

    • Use Bateman-Mukai's method of moments for estimation of mutation parameters

    • Consider maximum likelihood approaches for more accurate estimates with fewer assumptions

This experimental design offers several advantages:

  • Provides sufficient statistical power while minimizing experimental effort

  • Allows detection of subtle fitness effects that might be missed in direct competition assays

  • Can reveal condition-specific functions of yugP by comparing results across environmental conditions

The results from such experiments can provide insights into whether yugP is:

  • Under purifying selection (few tolerated mutations)

  • Under positive selection in specific environments (adaptive mutations)

  • Evolutionarily neutral (mutations accumulate without fitness consequences)

This information is crucial for understanding the evolutionary conservation of membrane proteases like yugP across bacterial species .

How does yugP interact with the biofilm formation pathway in Bacillus subtilis?

Recent research suggests a potential connection between yugP and biofilm formation in B. subtilis, particularly through its interaction with yugO, a putative potassium channel protein. The mstX-yugO operon has been identified as a regulator of biofilm formation, and given the high interaction score (0.956) between yugP and yugO, yugP may play a role in this process .

Experimental Approach to Investigate yugP-Biofilm Relationship:

  • Comparative Phenotypic Analysis:

    • Evaluate biofilm formation in wild-type, ΔyugP, and complemented strains using standard crystal violet assays

    • Analyze biofilm architecture using confocal microscopy with fluorescently labeled strains

  • Transcriptional Regulation Studies:

    • Determine if yugP expression is regulated by SinR, a master regulator of biofilm formation

    • Use reporter fusions to monitor yugP expression during different phases of biofilm development

  • Protein Localization Analysis:

    • Track localization of fluorescently tagged yugP during biofilm formation

    • Determine if yugP colocalizes with other biofilm-associated proteins

Research on related pathways indicates that the mstX-yugO operon is under the negative regulation of SinR, a transcription factor that governs the switch between planktonic and sessile states. Furthermore, mstX regulates Spo0A activity through a positive autoregulatory loop involving KinC, a histidine kinase activated by potassium leakage .

Given the functional relationship between yugP and yugO, yugP may contribute to biofilm formation through:

  • Processing of membrane proteins involved in matrix production

  • Regulation of ion homeostasis affecting KinC-Spo0A signaling

  • Direct proteolytic processing of biofilm matrix components

What methodological approaches best elucidate the role of yugP in membrane protein quality control networks?

To understand yugP's role in membrane protein quality control networks, researchers should employ a multi-faceted methodological approach:

  • Proteomic Identification of Substrates and Interactors:

    • Conduct SILAC-based quantitative proteomics comparing membrane fractions from wild-type and ΔyugP strains

    • Use GeLC experiments (gel electrophoresis followed by LC-MS/MS) to identify proteins migrating at lower-than-expected molecular weights in the yugP-expressing strain, indicating potential cleavage products

  • In Vivo Degradation Assays:

    • Monitor the stability of candidate substrate proteins using pulse-chase experiments

    • Compare degradation kinetics in wild-type, ΔyugP, and strains expressing catalytically inactive yugP

  • Reconstitution of the Degradation System:

    • Purify yugP and potential associated components like FtsH

    • Reconstitute the system in proteoliposomes with fluorescently labeled substrates

    • Monitor degradation in real-time using fluorescence-based assays

Research on the rhomboid protease YqgP revealed its interaction with the membrane-bound ATP-dependent metalloprotease FtsH, where YqgP acts both as a protease and as a substrate adaptor for FtsH. This dual functionality represents a primitive form of membrane protein quality control analogous to ER-associated degradation (ERAD) in eukaryotes .

Given the structural similarities between yugP and YqgP, a similar model might apply to yugP:

ComponentFunction in Quality Control Network
yugPInitial proteolytic processing of substrate; substrate recognition and presentation
FtsH or similar AAA+ proteaseProcessive degradation of substrate after initial processing
Accessory factorsRegulation of specificity and activity under different stress conditions

This integrated approach can reveal whether yugP functions similarly to YqgP in membrane protein quality control, potentially identifying a conserved mechanism for membrane proteostasis in Gram-positive bacteria .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.