Recombinant Bacillus subtilis Putative molybdenum transport system permease protein yvgM (yvgM)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yvgM; BSU33390; Putative molybdenum transport system permease protein YvgM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yvgM
Target Protein Sequence
MALLPSSISASEFFTPVVLSFQVAAVAGIVVIILGTLAGAWMSRASFFGKTALETCFMLP LVLPPTVVGFILIVIFGKHSFIGQAIEWIFQQPVIFTWWAAVIASAVVAFPLMYQSAKTG FADIDPDIQGAAMVDGASRWKVFIHISVPLAYPSLLTGSILSLARALGEFGATLMFAGNI PGVTQTLPTAIYVALDSGNNTLAWAWVVCIVVISFLMLFFIQQKKTH
Uniprot No.

Target Background

Function
This protein may be a component of the binding-protein-dependent molybdenum transport system, likely responsible for substrate translocation across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of yvgM in Bacillus subtilis?

yvgM is identified as a putative molybdenum transport permease that likely functions as part of a binding-protein-dependent transport system for molybdenum. Current evidence suggests it is responsible for the translocation of molybdenum substrates across the bacterial membrane . The protein appears to function similarly to other bacterial permeases involved in nutrient acquisition, forming a critical component of the molecular machinery that enables B. subtilis to uptake molybdenum, an essential micronutrient for various metabolic processes.

How does yvgM compare structurally and functionally to other bacterial transport systems?

While detailed structural information specific to yvgM is limited, it shares conceptual similarities with other characterized B. subtilis transport systems. The YtrBCDEF ABC transporter, for example, represents a well-studied system that consists of nucleotide binding proteins (YtrB and YtrE), membrane-spanning proteins (YtrC and YtrD), and a substrate binding protein (YtrF) . The yvgM protein likely participates in a similar multicomponent system specialized for molybdenum transport. Unlike the YtrBCDEF system, which influences cell wall properties, competence development, and biofilm formation , the broader physiological impacts of yvgM require further investigation.

What are effective strategies for recombinant expression of yvgM in B. subtilis?

Expression of membrane proteins like yvgM presents unique challenges that can be addressed through several approaches:

Expression StrategyKey ComponentsConsiderations
Promoter selectionIPTG-inducible Pgrac promoter with lac operatorAllows controlled expression with temporal regulation
Chassis strain engineeringStrains with reduced autolysis (e.g., knockout of lytC, sigD, pcfA)Increases biomass and protein yield by 10-20%
Secretion system optimizationamyQ secretion signal sequenceEnables extracellular secretion via Sec pathway
Codon optimizationB. subtilis preferred codonsEnhances translation efficiency

For membrane proteins specifically, strain engineering approaches that strengthen cell wall integrity while maintaining membrane function are particularly valuable. The chronological lifespan engineering approach described for B. subtilis chassis cells offers promising avenues for improved expression .

What purification challenges are specific to yvgM as a membrane protein?

Membrane proteins present distinct purification challenges that require specialized protocols:

  • Membrane extraction requires careful selection of detergents that solubilize the protein without denaturing it

  • Detergent screening is often necessary to identify conditions that maintain protein stability

  • Affinity chromatography can be employed using engineered tags, though tag placement must avoid interfering with membrane topology

  • Size exclusion chromatography in the presence of appropriate detergents helps achieve higher purity

  • Functional assays must be developed to confirm that purified protein maintains transport activity

How can researchers definitively determine if yvgM is essential for molybdenum transport?

A comprehensive approach to establish yvgM's role in molybdenum transport would include:

  • Generation of precise yvgM deletion mutants using CRISPR-Cas9 or traditional homologous recombination

  • Complementation studies to restore function and confirm phenotype specificity

  • Growth assays comparing wild-type and ΔyvgM strains under molybdenum-limited conditions

  • Direct measurement of molybdenum uptake using radioactive tracers or ICP-MS

  • Assessment of molybdenum-dependent enzyme activities (e.g., nitrate reductase)

Similar gene knockout approaches have been successfully employed to characterize the YtrBCDEF transporter system, revealing its impact on competence, biofilm formation, and cell wall thickness .

What experimental approaches can reveal potential interactions between yvgM and other transport system components?

To identify and characterize protein-protein interactions:

  • Bacterial two-hybrid assays adapted for membrane proteins can detect binary interactions

  • Co-immunoprecipitation with epitope-tagged yvgM can pull down interacting partners

  • Protein crosslinking followed by mass spectrometry can map interaction interfaces

  • Genetic suppressor screens can identify functional relationships between components

  • Fluorescence resonance energy transfer (FRET) can validate interactions in vivo

Research on the YtrBCDEF system demonstrated that individual components like YtrF play crucial roles in system functionality, suggesting similar studies could reveal important insights about yvgM's interactions .

How can researchers elucidate the transport mechanism of yvgM at the molecular level?

Understanding the molecular mechanism requires multiple complementary approaches:

  • Site-directed mutagenesis of conserved residues to identify those critical for transport

  • Reconstitution of purified yvgM into liposomes for in vitro transport assays

  • Structural studies using X-ray crystallography or cryo-electron microscopy

  • Molecular dynamics simulations to model substrate movement through the channel

  • Electrophysiological measurements if ion coupling is involved in transport

What techniques can assess how environmental conditions regulate yvgM expression and function?

To characterize regulatory mechanisms:

  • Promoter-reporter fusions (yvgM promoter with fluorescent protein) can monitor expression under different conditions

  • Quantitative RT-PCR can measure transcriptional responses to varying molybdenum concentrations

  • Chromatin immunoprecipitation can identify transcription factors binding to the yvgM promoter

  • RNA-seq comparing wild-type and regulatory mutants can place yvgM in broader regulatory networks

  • Proteomics approaches can assess post-translational modifications affecting protein activity

The YtrBCDEF system shows induction by cell wall-targeting antibiotics and regulates cell wall thickness , suggesting environmental sensing may be similarly important for yvgM regulation.

How does yvgM function potentially interact with competence development in B. subtilis?

Competence development in B. subtilis is tightly regulated and can be influenced by membrane proteins and transporters. Potential approaches to investigate connections include:

  • Examining transformation efficiency in yvgM mutants compared to wild-type

  • Assessing ComK activity and competence gene expression in the presence/absence of yvgM

  • Investigating whether molybdenum availability affects competence development

  • Determining if cell wall properties are altered in yvgM mutants, potentially affecting DNA uptake

The YtrBCDEF ABC transporter has been shown to influence genetic competence in B. subtilis, with its overexpression causing loss of competence through changes in cell wall thickness (increasing from 21 nm to 31 nm) . A similar mechanism might apply to yvgM if it affects cell envelope properties.

What is the relationship between yvgM function and biofilm formation?

To investigate potential connections to biofilm formation:

  • Compare biofilm architecture between wild-type and yvgM mutant strains using microscopy

  • Assess biofilm formation on MSgg agar, which induces biofilm development

  • Evaluate expression of biofilm-related genes in yvgM mutants

  • Determine if molybdenum availability influences biofilm development

  • Examine cell wall properties, as these can impact biofilm formation

The YtrBCDEF system has been shown to affect biofilm formation in B. subtilis, with ytrA mutants forming less structured, more translucent biofilms with fewer surface wrinkles . This suggests transporters can significantly impact this complex developmental process.

What are the most effective techniques for determining the structure of membrane proteins like yvgM?

Membrane protein structural analysis requires specialized approaches:

TechniqueAdvantagesLimitationsSample Requirements
X-ray crystallographyHigh resolution (potentially <2Å)Difficult crystallizationMilligram quantities of pure, stable protein
Cryo-electron microscopyNo crystallization needed, near-native stateLower resolution for smaller proteinsMicrogram quantities, homogeneous samples
NMR spectroscopyDynamic information, solution stateSize limitations (~50 kDa limit)Isotope-labeled protein
Computational modelingNo experimental sample neededAccuracy depends on template qualityHomologous structures as templates

How can researchers investigate the substrate binding properties of yvgM?

To characterize molybdenum binding:

  • Isothermal titration calorimetry with purified protein to measure binding affinity

  • Fluorescence spectroscopy with intrinsic or extrinsic fluorophores to detect conformational changes upon binding

  • Surface plasmon resonance to assess binding kinetics

  • Mutagenesis of predicted binding site residues followed by functional assays

  • Computational docking to predict binding modes

How conserved is yvgM across different Bacillus species and other bacterial genera?

Comparative genomics approaches can reveal evolutionary patterns:

  • Phylogenetic analysis of yvgM homologs across bacterial species

  • Examination of genomic context conservation to identify functional associations

  • Analysis of selection pressure on different protein domains

  • Comparison with experimentally characterized homologs in other species

  • Functional complementation studies across species boundaries

What insights can be gained by comparing yvgM to the YtrBCDEF transport system?

The well-characterized YtrBCDEF system offers valuable comparative insights:

  • Both systems likely function as multicomponent transporters with different substrate specificities

  • While YtrBCDEF affects cell wall thickness, competence, and biofilm formation , similar pleiotropic effects might exist for yvgM

  • YtrBCDEF is induced by cell wall-targeting antibiotics , suggesting environmental regulation that could parallel yvgM regulation

  • The substrate binding protein YtrF contains FtsX-like and MacB-like domains that interact with other cellular components , potentially indicating similar interaction modes for yvgM

  • Genetic manipulation approaches successful for YtrBCDEF can guide experimental design for yvgM characterization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.