Recombinant Bacillus subtilis Putative oxidoreductase mhqP (mhqP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mhqP; ydfP; BSU05500; Putative oxidoreductase MhqP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
mhqP
Target Protein Sequence
MEDAGLLLIRIMIGVVFLFYGTQKLFGWFGGYGIKGTGQWFESIGVKPGNVAAALSGLGE LVSGILFILGVFLPLGAAIITIIMLGAIVKVHGAKGFANGAGGFEYNLVLIAVSIGVALI GSGAYALHF
Uniprot No.

Target Background

Function
Putative oxidoreductase potentially involved in the degradation of aromatic compounds.
Database Links
Protein Families
DoxX family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is mhqP and what is its functional role in Bacillus subtilis?

The mhqP (formerly ydfP) is a putative oxidoreductase that functions as part of the mhqNOP operon in Bacillus subtilis. This operon encodes multiple dioxygenases/glyoxalases that confer resistance to toxic compounds such as 2-methylhydroquinone (2-MHQ) and catechol. The mhqP protein (UniProt accession: P96694) is regulated by the MarR-type repressor MhqR (formerly YkvE) and is induced during thiol-specific stress responses . Although classified as an oxidoreductase, detailed enzymatic characterization studies are still needed to definitively establish its precise catalytic mechanism and substrate specificity.

How is the expression of mhqP regulated in Bacillus subtilis?

The mhqP gene is part of a regulon controlled by the MhqR repressor. Transcriptional regulation occurs through MhqR binding to a primary imperfect inverted repeat with the consensus sequence tATCTcgaAtTCgAGATaaaa in the promoter regions of target genes, including the mhqNOP operon . Under normal conditions, MhqR binds to this operator sequence and represses transcription. During thiol stress conditions, such as exposure to 2-MHQ or catechol, MhqR-mediated repression is relieved, allowing increased transcription from a σA-type promoter upstream of the mhqNOP operon. DNase I footprinting analyses have confirmed MhqR binding to these regulatory regions, and subsequent gene expression studies using promoter-reporter fusions have validated this regulatory mechanism in vivo .

What are the optimal storage and handling conditions for recombinant mhqP protein?

For optimal stability and activity of recombinant mhqP protein, the following storage conditions are recommended:

  • Liquid formulations should be stored at -20°C/-80°C with an expected shelf life of approximately 6 months

  • Lyophilized preparations maintain stability for up to 12 months when stored at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles which can significantly reduce enzyme activity

  • Working aliquots can be maintained at 4°C for up to one week without significant loss of activity

The shelf life is influenced by multiple factors including buffer composition, storage temperature, and the intrinsic stability of the protein itself. For long-term storage, addition of 5-50% glycerol (final concentration) as a cryoprotectant is recommended .

What expression systems are suitable for producing recombinant mhqP?

While E. coli has been widely used for heterologous expression of B. subtilis proteins, mammalian cell expression systems have been successfully employed for producing recombinant mhqP with high purity (>85% as verified by SDS-PAGE) . When selecting an expression system, researchers should consider:

  • Codon optimization for the chosen expression host

  • Addition of appropriate purification tags (determined during the manufacturing process)

  • Optimization of induction conditions to maximize soluble protein yield

  • Implementation of efficient purification protocols to achieve >85% purity

For structural and functional studies, it is advisable to verify the enzymatic activity of the recombinant protein using appropriate substrate oxidation/reduction assays that monitor NAD(P)H conversion through spectrophotometric methods, similar to approaches used for characterizing other oxidoreductases .

How should recombinant mhqP be reconstituted for experimental use?

For optimal reconstitution of recombinant mhqP:

  • Briefly centrifuge the vial prior to opening to ensure all material is at the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL

  • For long-term storage preparations, add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

  • Aliquot the reconstituted protein into single-use volumes to avoid repeated freeze-thaw cycles

Following reconstitution, verify protein activity using appropriate enzymatic assays before proceeding with experimental applications.

What experimental approaches are most effective for determining mhqP substrate specificity?

To comprehensively characterize mhqP substrate specificity, a multi-faceted approach is recommended:

  • Spectrophotometric enzyme assays: Monitor the oxidation/reduction of NAD(P)H at 340 nm when mhqP is incubated with potential substrates. This approach has been successfully used for other oxidoreductases .

  • Substrate screening panels: Test activity against a diverse array of potential substrates including various quinones, aromatics, and aldehydes, starting with 2-MHQ and catechol which are known inducers of the mhqP expression system .

  • Structural analysis: Crystallographic studies of mhqP in complex with substrate candidates can provide direct evidence of binding interactions, similar to the approach used for human ALDH3A1 complexed with octanal .

  • Site-directed mutagenesis: Identify and modify putative active site residues to evaluate their contribution to substrate binding and catalysis.

  • Comparative analysis: Leverage information from characterized oxidoreductases in the same regulon (such as MhqA and MhqO) that have been shown to confer resistance to 2-MHQ .

How can the physiological role of mhqP in quinone detoxification be validated experimentally?

To definitively establish mhqP's role in quinone detoxification, consider the following experimental approaches:

  • Gene deletion studies: Construct Δmhq mutants and evaluate their sensitivity to 2-MHQ and catechol compared to wild-type B. subtilis. Previous studies have shown that mutations in related genes (MhqA, MhqO, and AzoR2) confer resistance to 2-MHQ .

  • Complementation analysis: Reintroduce mhqP into deletion strains to confirm that the observed phenotypes are directly attributable to mhqP.

  • In vitro detoxification assays: Measure the conversion rates of toxic quinones in the presence of purified mhqP and appropriate cofactors.

  • Metabolite analysis: Use chromatographic methods coupled with mass spectrometry to identify and quantify the metabolic products formed when mhqP acts on potential substrates.

  • Transcriptional response analysis: Monitor the expression patterns of mhqP and related genes under varying concentrations of toxic compounds using quantitative PCR or RNA-seq approaches.

How does mhqP interact with other components of the MhqR regulon in B. subtilis?

The functional interplay between mhqP and other proteins in the MhqR regulon involves complex regulatory and metabolic interactions:

  • Coordinated regulation: The genes regulated by MhqR include mhqA (ykcA), mhqNOP (ydfNOP), mhqED (yodED), and azoR2 (yvaB), all of which encode dioxygenases, glyoxalases, oxidoreductases, or azoreductases . These proteins likely function in concert within related metabolic pathways.

  • Redundancy analysis: While MhqA, MhqO, and AzoR2 have been shown to confer resistance to 2-MHQ, the specific contribution of mhqP requires further investigation .

  • Protein-protein interaction studies: Techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or cross-linking experiments could reveal whether mhqP physically interacts with other proteins in the regulon.

  • Metabolic flux analysis: Investigating how metabolites flow through pathways involving multiple MhqR-regulated enzymes could clarify the position of mhqP in quinone detoxification pathways.

What strategies can address the challenges of obtaining enzymatically active recombinant mhqP?

Researchers face several challenges when producing active recombinant mhqP. Consider these strategies to overcome common obstacles:

  • Expression system optimization: While mammalian cell expression has been used successfully , bacterial systems like E. coli can be optimized by:

    • Using specialized strains with enhanced disulfide bond formation capabilities

    • Co-expressing molecular chaperones to assist proper folding

    • Optimizing induction temperature (typically lowering to 16-25°C)

    • Testing various solubility-enhancing fusion tags

  • Cofactor considerations: Ensure appropriate cofactors (NAD+/NADH or NADP+/NADPH) are present during activity assays, as oxidoreductases are dependent on these for catalytic function .

  • Protein stability enhancement: Implement buffer optimization screening to identify conditions that maximize stability, potentially including:

    • Addition of glycerol or other stabilizing agents

    • Testing various pH conditions

    • Including reducing agents if thiol groups are crucial for activity

  • Activity verification: Develop sensitive and reliable assays to confirm that the recombinant enzyme retains catalytic activity, using approaches similar to those employed for other characterized oxidoreductases .

How can apparent contradictions between in vitro and in vivo studies of mhqP be reconciled?

When facing discrepancies between in vitro biochemical data and in vivo phenotypic observations related to mhqP function, consider these methodological approaches:

  • Physiological context reconstruction: Standard in vitro reaction conditions often differ substantially from the intracellular environment. Consider incorporating physiologically relevant:

    • pH and ionic strength

    • Macromolecular crowding agents

    • Potential protein partners or effectors

    • Realistic substrate and cofactor concentrations

  • Redundancy assessment: B. subtilis may possess functionally redundant systems that compensate for mhqP deletion in vivo. Construct multiple gene knockout strains to reveal synergistic effects that might be masked by redundancy .

  • Post-translational modifications: Investigate whether mhqP undergoes modifications in vivo that affect its activity but are absent in recombinant systems.

  • Localization studies: Determine whether subcellular localization influences mhqP activity by using fluorescent protein fusions or fractionation studies.

  • System-level analysis: Apply metabolomic or transcriptomic approaches to capture the broader impact of mhqP on cellular physiology beyond direct enzymatic activity.

What bioinformatic approaches can predict the structural features and catalytic mechanism of mhqP?

In the absence of experimental structural data, computational approaches can provide valuable insights into mhqP:

  • Homology modeling: Generate structural models based on related oxidoreductases with known structures. Particular attention should be paid to:

    • Conservation of catalytic residues

    • Cofactor binding sites

    • Substrate binding pocket geometry

  • Sequence analysis: Perform multiple sequence alignments with characterized oxidoreductases to identify conserved motifs and catalytically important residues.

  • Molecular docking: Predict interactions between mhqP models and potential substrates like 2-MHQ and catechol to guide experimental validation.

  • Molecular dynamics simulations: Investigate the dynamic behavior of mhqP and its interactions with substrates and cofactors under simulated physiological conditions.

  • Evolutionary analysis: Examine the distribution and conservation of mhqP across bacterial species to gain insights into its evolutionary history and functional importance.

What are common pitfalls in mhqP activity assays and how can they be addressed?

Researchers may encounter several challenges when assessing mhqP enzymatic activity:

  • Background reactivity: Some substrates may undergo spontaneous oxidation/reduction. Always include appropriate controls lacking enzyme to establish baseline rates.

  • Cofactor preference uncertainty: Test both NAD(P)H and NAD(P)+ as potential cofactors, as the preferred electron donor/acceptor may not be immediately obvious for a putative oxidoreductase .

  • Inhibition by high substrate concentrations: Perform kinetic analyses across a range of substrate concentrations to identify potential substrate inhibition effects.

  • Enzyme stability during assays: Monitor activity over time to ensure the enzyme remains stable under assay conditions. Consider adding stabilizing agents if activity decreases rapidly.

  • Interference from buffer components: Some buffer components may interfere with spectrophotometric measurements or enzyme activity. Verify that chosen buffers are compatible with both the enzyme and detection method.

How can researchers distinguish between enzymatic and non-enzymatic reactions involving quinones?

Quinones are reactive compounds that can undergo non-enzymatic transformations, complicating the assessment of mhqP activity:

  • Heat-inactivated controls: Compare reaction rates using native and heat-denatured enzyme preparations.

  • Catalytic parameters: Determine kinetic parameters (Km, kcat) that should follow Michaelis-Menten kinetics for enzyme-catalyzed reactions but not for non-enzymatic processes.

  • Substrate specificity profiling: Enzymatic reactions typically show defined substrate specificity patterns, while non-enzymatic reactions often exhibit broader reactivity.

  • pH dependence profiles: Enzymatic reactions usually display bell-shaped pH-activity profiles reflecting ionization states of catalytic residues.

  • Product analysis: Use analytical techniques like HPLC-MS to confirm that the reaction products from enzymatic reactions match the expected metabolites rather than products of spontaneous reactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.