Recombinant Bacillus subtilis Putative penicillin-binding protein pbpX (pbpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with additional charges; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pbpX; BSU16950; Putative penicillin-binding protein PbpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
pbpX
Target Protein Sequence
MTSPTRRRTAKRRRRKLNKRGKLLFGLLAVMVCITIWNALHRNSEENEPSQETAAVSNTD QKKEVKKKTAKKSEEQIKTVDRNQKISNYLKEIGFSGTAMIVRNGEIVTNKGFGYADRKH YIQNNPLTSFYVGSSQKALIATAILQLEEKGKLQTSDPVSTYLPHFPNGQTITLKNLLTH TSGINGHIEGNGAITPDDLIKDIELQGIKRQPGVWDYKDSNYSVLAYIIAEVSGEPYEQY IKNHIFKPAGMTHAGFYKTYEKEPYPAVGYKMEGSKTVTPYIPDLSQLYGAGDIYMSAID MYKFDQALIDGKLYSQKSYEKMFTPGSSSTYGMGFYVAPGSYSNHGVMPGFNILNSFSKS GQTIVILFSNIQNNAKLGQVNNKIYQLLNQE
Uniprot No.

Target Background

Database Links
Protein Families
Beta-lactamase family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is pbpX and what is its functional role in Bacillus subtilis?

PbpX (penicillin-binding protein X) is one of the 16 penicillin-binding proteins encoded by the B. subtilis genome . It functions as a putative endopeptidase involved in peptidoglycan remodeling during cell growth and division . PbpX belongs to the family of proteins that are the targets of β-lactam antibiotics, which bind to the catalytic serine in their active sites .

How can I detect and visualize native pbpX in Bacillus subtilis?

Methodological approach:

  • Fluorescent tagging: Create a GFP-pbpX fusion protein by cloning the pbpX gene into a GFP vector with an appropriate promoter for expression in B. subtilis .

  • Activity-based labeling: Use Bocillin-FL, a fluorescent derivative of penicillin V that binds to active PBPs including pbpX . This method allows visualization of all active PBPs at once.

  • Immunofluorescence microscopy: Develop antibodies specific to pbpX and use them for immunostaining followed by fluorescence microscopy. This requires membrane permeabilization while preserving cell morphology.

  • Time-lapse microscopy: For dynamic studies of pbpX localization during sporulation, use time-lapse microscopy with membrane dyes such as FM 4-64 in combination with fluorescently tagged pbpX .

Detection MethodAdvantagesLimitationsBest Application
GFP fusionLive cell imaging; real-time dynamicsMay affect protein functionDynamic localization studies
Bocillin-FLLabels all active PBPs; activity-basedCannot distinguish specific PBPs without additional analysisComparative studies of multiple PBPs
ImmunofluorescenceSpecific to target proteinRequires fixation; potential artifactsFixed-cell detailed localization
Western blot with Bocillin-FLQuantitative assessment of activityIn vitro analysis onlyActivity measurement across conditions

How is the pbpX gene regulated in Bacillus subtilis?

PbpX expression is regulated by the extracytoplasmic-function σX factor, which is one of seven ECF sigma factors in B. subtilis that activate partially overlapping regulons . The σX regulon includes genes involved in cell envelope functions, particularly those affecting cell surface properties and resistance to antimicrobial peptides.

To experimentally determine pbpX regulation:

  • Promoter-reporter fusions: Create a pbpX promoter-cat-lacZ fusion and introduce it into the SPβ prophage by double-crossover recombination. Measure β-galactosidase activity to quantify promoter activity under different conditions .

  • RNA polymerase-σX factor in vitro experiments: Perform reconstituted transcription assays using purified B. subtilis core RNA polymerase, σX factor, and a DNA template containing the pbpX promoter .

  • Run-off transcription assay: Use PCR-amplified pbpX promoter fragments as templates with core RNAP, σX, and radiolabeled nucleotides to confirm direct transcription activation by σX .

What methodologies are effective for studying the role of pbpX in cell wall remodeling during sporulation?

Studying pbpX during sporulation requires techniques that can track protein localization, measure enzymatic activity, and assess cell wall structural changes:

  • Dynamic protein localization: Create angle-based kymographs along forespore membranes to track pbpX movement during engulfment . This involves:

    • Fluorescent labeling of membranes (FM 4-64) and pbpX-GFP

    • Time-lapse microscopy capturing the medial focal plane

    • Image analysis calculating angular positions relative to the mother-forespore reference frame

    • Alignment of cells based on septum curving onset

  • Cell wall synthesis visualization: Use fluorescent D-amino acids to label sites of new peptidoglycan synthesis and correlate with pbpX localization .

  • Leading edge (LE) tracking: Measure the decrease in distance between the two leading edges of the engulfing membrane (gap arc length) to assess membrane movement around the forespore .

  • Antibiotic inhibition studies: Use specific antibiotics like cephalexin (inhibits PBP activity) and bacitracin (blocks cell-wall precursor delivery) to assess the contribution of pbpX to engulfment when other PBPs are inhibited .

  • Cryo-electron tomography: Visualize the thin peptidoglycan layer between septal membranes throughout engulfment to understand how pbpX contributes to cell wall remodeling .

How does environmental pH affect the activity of pbpX compared to other PBPs in Bacillus subtilis?

Environmental pH significantly affects the activity of various PBPs in B. subtilis, suggesting specialized roles for different PBPs under different pH conditions. To study this:

  • Alkaline shock experiments:

    • Culture B. subtilis to early exponential phase

    • Expose cells to gradients of alkaline pH in PBS for 30 minutes

    • Incubate with Bocillin-FL to label active PBPs

    • Isolate cell membranes and analyze by SDS-PAGE with fluorescence scanning

  • Comparative analysis across pH range:

    • Test pbpX activity alongside other PBPs at pH values from 7.0 to 11.0

    • Quantify fluorescence intensity of Bocillin-FL labeling for each PBP

    • Determine pH thresholds at which pbpX activity changes

  • In vivo versus in vitro analysis:

    • Compare pbpX activity after base treatment of whole cells versus cell lysates

    • This helps distinguish whether pH effects require cellular machinery or are purely biochemical

Research findings show that some PBPs (PBPH, PBP4) lose activity at alkaline pH, while PBP1a shifts to PBP1b . The behavior of pbpX under different pH conditions provides insights into its specialized role in the cell wall synthesis machinery.

What are the most effective strategies for expressing and purifying recombinant pbpX protein?

For successful expression and purification of recombinant pbpX:

  • Expression system selection:

    • E. coli systems: Good for initial characterization but may lack proper folding

    • B. subtilis expression: Preferred for authentic protein modification and activity

    • Baculovirus systems: Useful for higher yields with proper folding

  • Optimization for B. subtilis expression:

    • Use protease-deficient strains to prevent degradation of the recombinant protein

    • Screen a library of secretion signal peptides to enhance protein translocation

    • Optimize codon usage for efficient translation

  • Tags and purification strategies:

    • N-terminal or C-terminal tags determined by tag-protein stability considerations

    • Affinity chromatography (His-tag, GST-tag) followed by size exclusion chromatography

    • Consider on-column refolding for improved solubility

  • Activity preservation:

    • Include appropriate cofactors during purification

    • Add stabilizing agents to prevent unfolding

    • Store at -20°C or -80°C for long-term storage with minimal freeze-thaw cycles

Expression SystemAdvantagesDisadvantagesYield
E. coliFast growth, easy manipulationPotential folding issuesVariable
B. subtilisNative environment, secretion capabilityProteolytic degradationHigh (g/L possible)
BaculovirusHigher eukaryotic processingMore complex systemMedium to high

How can I design a CRISPR-Cas9 system to effectively modify the pbpX gene in Bacillus subtilis?

Implementing CRISPR-Cas9 for pbpX modification requires a streamlined approach:

  • Leveraging existing resources:

    • Utilize the BKE collection of nearly 4000 B. subtilis strains as starting material

    • This collection already contains numerous characterized genetic backgrounds

  • Design considerations:

    • Select appropriate sgRNA target sites in the pbpX gene with minimal off-target effects

    • Include 20 nt target sequence adjacent to a PAM site (NGG for Cas9)

    • Design homology-directed repair templates with desired modifications flanked by homology arms (500-1000 bp)

  • Implementation strategy:

    • Use a temperature-sensitive plasmid expressing Cas9 and sgRNA

    • Transform with the homology-directed repair template

    • Screen transformants for successful editing using PCR and sequencing

    • Cure the Cas9 plasmid by temperature shift

  • Alternative modification approaches:

    • For marker replacement mutations, use isothermal "Gibson" assembly

    • Amplify regions upstream and downstream of pbpX with specific primer pairs

    • Include antibiotic resistance markers (e.g., kanamycin resistance gene)

    • Transform into B. subtilis and select for resistance

This approach avoids the limitations of traditional single-crossover integrations that can have polar effects and genetic instability .

How can I assess the functional redundancy between pbpX and other PBPs in Bacillus subtilis?

To investigate potential functional redundancy between pbpX and other PBPs:

  • Single and multiple gene knockout strategy:

    • Create single knockout mutants of pbpX and other PBPs

    • Generate double, triple, and higher-order knockout combinations

    • Assess viability and growth phenotypes under different conditions

  • Conditional expression systems:

    • Place pbpX or other redundant PBPs under inducible promoter control

    • Deplete one PBP while monitoring the effects in backgrounds with other PBPs deleted

    • This approach has revealed that PBP2a and PbpH play redundant roles in rod shape formation

  • Stress response assessment:

    • Subject mutant strains to various stressors (pH, temperature, antibiotics)

    • Compare growth, morphology, and survival rates

    • For example, test alkaline sensitivity in PBP-null mutants as done for other PBPs

  • Bocillin-FL competition assays:

    • Use varying concentrations of β-lactam antibiotics that preferentially target specific PBPs

    • Measure the inhibition profile of Bocillin-FL binding to determine overlap in binding sites

    • Analyze with SDS-PAGE and fluorescence scanning

The functional redundancy between PBPs has been demonstrated in studies showing that while pbpX knockout alone shows no distinguishable phenotype, combinations of PBP knockouts can lead to synthetic lethality or significant morphological defects .

Why might my pbpX-GFP fusion protein show irregular localization patterns?

Several factors can cause irregular localization of pbpX-GFP fusions:

  • Fusion protein design issues:

    • The position of GFP tag may interfere with proper localization

    • Try both N-terminal and C-terminal fusions, as well as internal fusions

    • Include flexible linker sequences between pbpX and GFP

  • Expression level problems:

    • Overexpression can cause aggregation and mislocalization

    • Use native promoter strength or tunable promoters

    • Verify expression levels by western blotting

  • Growth phase considerations:

    • PBP localization changes dramatically during different growth phases

    • PbpX specifically changes localization during sporulation

    • Standardize cell culture conditions and timing of observations

  • Technical imaging issues:

    • Insufficient resolution (use deconvolution or super-resolution microscopy)

    • Photobleaching during extended imaging

    • Z-stack acquisition problems missing the spiraling pattern of pbpX

  • Physiological state variations:

    • Environmental stressors can alter PBP localization and activity

    • pH changes significantly affect some PBPs

    • Control growth media composition and environmental conditions

How can I resolve contradictory results between in vivo and in vitro pbpX activity assays?

When facing contradictions between in vivo and in vitro results:

  • Systematic comparison of conditions:

    • Create a matrix of experimental conditions comparing:

      • In vivo labeling followed by lysis and analysis

      • Lysis followed by in vitro labeling

      • In vivo treatment, lysis, then labeling

      • In vitro treatment of pre-labeled samples

  • Buffer composition considerations:

    • Cell lysis disrupts the native membrane environment

    • Try different buffer compositions to mimic the native environment

    • Include appropriate ions (Mg²⁺, Ca²⁺) and membrane components

  • Activity-preserving sample preparation:

    • Minimize time between cell disruption and analysis

    • Maintain consistent temperature throughout sample processing

    • Consider native membrane fraction isolation instead of protein purification

  • Technical validation:

    • Use multiple complementary approaches to measure activity

    • Compare Bocillin-FL labeling with direct enzymatic activity assays

    • Verify protein integrity with western blotting

Research has shown that some PBP activities (like PBP1b activation) require intact cells, indicating that cellular machinery is necessary for proper function, while other pH-dependent activities (like PBP4 inactivation) are purely biochemical .

What are promising approaches for studying pbpX interactions with the cell division machinery?

Future research on pbpX interactions should focus on:

  • Protein-protein interaction mapping:

    • Bacterial two-hybrid screens to identify interaction partners

    • Cross-linking mass spectrometry to capture transient interactions

    • Co-immunoprecipitation with tagged pbpX followed by proteomics

  • Super-resolution microscopy:

    • PALM/STORM imaging to resolve nanoscale colocalization of pbpX with FtsZ and other division proteins

    • Multi-color imaging to simultaneously track multiple components

    • Correlative light-electron microscopy to link protein localization with ultrastructural features

  • In situ activity assays:

    • Development of FRET-based sensors to monitor pbpX enzymatic activity in living cells

    • Substrate analogs that change fluorescence properties upon processing by pbpX

  • Cryo-electron tomography:

    • Visualize the 3D architecture of the division machinery and pbpX localization

    • Use cellular cryo-ET to study native state interactions without fixation artifacts

    • Correlate with fluorescence microscopy data for comprehensive understanding

The spiraling pattern of pbpX during sporulation resembling FtsZ redistribution suggests a potential interaction with the cell division machinery that warrants further investigation .

How might understanding pbpX function contribute to developing new antimicrobial strategies?

PbpX research has significant implications for antimicrobial development:

  • PBP specialization under stress conditions:

    • The differential activity of PBPs under varying pH conditions suggests potential for targeted inhibition strategies

    • Design antibiotics that selectively target PBPs active under specific environmental conditions

  • Redundancy-targeting approaches:

    • Identify combinations of PBPs that, when simultaneously inhibited, cannot be compensated by redundant functions

    • Develop combination therapies targeting multiple PBPs to overcome functional redundancy

  • Species-specific targeting:

    • Compare pbpX across bacterial species to identify structural differences

    • Design inhibitors that selectively target pbpX in pathogens while sparing beneficial bacteria

  • Alternative inhibition strategies:

    • Target the regulatory pathways controlling pbpX expression

    • Inhibit σX factor to downregulate multiple cell envelope functions simultaneously

    • Disrupt protein-protein interactions essential for pbpX function

Understanding the specialized roles of individual PBPs under different environmental conditions represents a promising avenue for developing more targeted antimicrobial strategies that can overcome resistance mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.