Recombinant Bacillus subtilis Putative polysaccharide deacetylase yheN (yheN)

Shipped with Ice Packs
In Stock

Description

Physiological Role and Functional Hypotheses

Polysaccharide deacetylases (PDAs) in Bacillus spp. modify peptidoglycan (PG) or exopolysaccharides, influencing:

  • Lysozyme resistance: Deacetylation of N-acetylglucosamine (GlcNAc) residues in PG protects against host lysozyme .

  • Spore germination: Muramic δ-lactam formation in spore PG, mediated by PdaA, facilitates germination-specific cortex lysis .

  • Stress adaptation: O-linked acetylation of xylose residues in polysaccharides may enhance osmotic tolerance .

While YheN shares sequence homology with CE4 enzymes, its specific substrate (GlcNAc vs. MurNAc) and biological role remain uncharacterized. Homologs like B. subtilis PdaC exhibit MurNAc deacetylase activity , whereas PdaA is essential for spore cortex formation . YheN’s function may overlap with these roles or address novel pathways, such as:

  • Cell wall remodeling during growth phases.

  • Regulation of biofilm formation.

  • Antimicrobial resistance mechanisms.

Recombinant Production and Purification

The recombinant YheN protein is expressed in E. coli and purified via nickel-affinity chromatography . Key parameters include:

ParameterValue
Expression HostE. coli BL21(DE3) pLysS
Induction0.2 mM IPTG at 17°C
Purification MethodHisTrap HP column followed by TEV protease cleavage
Final Concentration23.6 mg/mL (after SEC and concentration)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0

The absence of published enzymatic assays for YheN highlights a critical gap in understanding its catalytic activity. Comparative studies with PdaC (MurNAc deacetylase) or PdaA (spore-related) could elucidate its substrate specificity .

Comparison with Other B. subtilis PDAs

EnzymeSubstrateBiological RoleKey References
YheNHypotheticalPutative PG/exopolysaccharide modification
PdaAMurNAc (spore PG)Spore cortex formation, germination
PdaCMurNAc (vegetative PG)Lysozyme resistance, cell wall stability
YjeAGlcNAc (PG)Deacetylation of PG oligomers

YheN’s exclusion from spore-related studies (e.g., ) suggests a distinct functional niche, potentially linked to vegetative growth or environmental adaptation.

Biotechnological Potential

  • Protein secretion optimization: PDAs may modulate cell wall permeability, enhancing recombinant protein yields in B. subtilis .

  • Antibiotic resistance studies: Deacetylation alters PG structure, impacting β-lactam susceptibility .

  • Synthetic biology: Engineering YheN for polysaccharide deacetylation in biofuel or biopolymer production.

Challenges

  1. Lack of enzymatic data: No published assays confirm YheN’s substrate or metal dependencies (e.g., Zn²⁺, Mg²⁺).

  2. Functional redundancy: Overlapping roles with PdaA/PdaC may obscure its biological significance.

  3. Structural ambiguity: Crystallization or cryo-EM studies are needed to resolve its catalytic mechanism.

Future Directions

To advance YheN research, prioritize:

  1. Biochemical assays: Test deacetylation activity on PG fragments or synthetic substrates.

  2. Gene knockout studies: Assess phenotypic changes in ΔyheN mutants under stress conditions.

  3. Structural biology: Solve its crystal structure to identify active-site residues and substrate-binding motifs.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yheN; BSU09660; Putative polysaccharide deacetylase YheN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yheN
Target Protein Sequence
MRQTRGEASPSAVSLAFKFASLAVLCVLLLLMVILGYSNSSTKAKEVTVTTNGQLRDEKE SLKLKNDSPDLLIKHLQTKQNMGDKTVYLTFDDGPSAVTTRLLDVLKSADVKATFFMLSP RMNEFKQAVKRAEKEGHALGLHGVTHNNRLFYQTPTSPLKEMQEARDTLQDITGYKTDLV RTPYGSKPSLTASQIRNLEKDGFVYWDWTIDSMDWKYRNSQYVTAVLQQLENMEHSSSSR PNVILMHDLPATVNALPVLINKLKEKGYSFGVLEDTMVPVHE
Uniprot No.

Target Background

Database Links
Protein Families
Polysaccharide deacetylase family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the basic function of Bacillus subtilis yheN protein?

Bacillus subtilis yheN is classified as a putative polysaccharide deacetylase (EC 3.-.-.-), suggesting its primary function involves removing acetyl groups from polysaccharide substrates . While the specific physiological substrates remain under investigation, the protein likely plays a role in cell wall modification, similar to other characterized polysaccharide deacetylases in Bacillus species . The protein is encoded by the yheN gene (locus BSU09660) in the Bacillus subtilis strain 168 genome .

How does yheN fit into B. subtilis biology?

B. subtilis is widely studied as a model organism and industrial workhorse due to its genetic manipulability, protein secretion capabilities, and non-pathogenic nature . As noted in recent literature, B. subtilis was named the "Microbe of the Year" in 2023 by the German Association for General and Applied Microbiology . The yheN protein likely contributes to cell wall modification processes, which are critical for cell growth, division, and adaptation to environmental stresses. Its function may be particularly relevant to B. subtilis' developmental processes, including sporulation, which involves significant cell wall remodeling .

What expression systems are optimal for recombinant yheN production?

Multiple expression systems have been successfully employed for yheN production, each with distinct advantages:

Expression SystemTag OptionsAdvantagesConsiderations
E. coliN-terminal 10xHis-tagHigh yield, cost-effective, rapid productionMay require optimization for proper folding
YeastVariablePost-translational modifications, proper foldingLonger production time, lower yield
BaculovirusVariableComplex folding, larger proteinsTechnical complexity, higher cost
Mammalian cellsVariableMost authentic post-translational modificationsHighest cost, lowest yield

What purification strategies are recommended for recombinant yheN?

The purification strategy depends on the expression system and protein tags. For His-tagged yheN expressed in E. coli:

  • Cell lysis: Sonication or pressure-based disruption in Tris/PBS-based buffer (pH 8.0)

  • Initial purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Further purification: Size exclusion chromatography to separate monomeric protein

  • Quality control: SDS-PAGE analysis to confirm >85% purity

For functional studies, additional considerations include:

  • Maintaining native conformation by using mild elution conditions

  • Including protease inhibitors throughout purification

  • Performing activity assays at each purification step to track enzymatic activity

How should researchers optimize storage conditions for yheN stability?

Optimal storage conditions for recombinant yheN include:

  • For lyophilized protein:

    • Store at -20°C or preferably -80°C

    • Shelf life approximately 12 months under these conditions

  • For liquid formulations:

    • Store in Tris/PBS-based buffer with 50% glycerol at pH 8.0

    • Aliquot to avoid repeated freeze-thaw cycles

    • Shelf life approximately 6 months at -20°C/-80°C

  • Working aliquots:

    • Can be maintained at 4°C for up to one week

    • Addition of 6% trehalose improves stability during storage

How can researchers assess the enzymatic activity of yheN?

To characterize the enzymatic activity of yheN as a polysaccharide deacetylase:

  • Substrate identification:

    • Test activity against model substrates like acetylated chitin, peptidoglycan fragments, or synthetic acetylated oligosaccharides

    • Monitor release of acetate using acetate detection kits or HPLC

  • Enzyme kinetics:

    • Determine optimal pH, temperature, and metal ion requirements

    • Calculate Km, Vmax, and kcat values using Michaelis-Menten kinetics

    • Compare with known deacetylases like AcuC and SrtN from B. subtilis

  • Confirmation of deacetylase activity:

    • Mass spectrometry to confirm substrate modification

    • NMR analysis to validate deacetylation position

    • In-gel activity assays using zymogram techniques with acetylated substrates

What approaches are effective for studying yheN's role in B. subtilis physiology?

Multiple complementary approaches can elucidate yheN's physiological function:

  • Gene knockout and complementation:

    • Create ΔyheN strains using established B. subtilis genetic techniques

    • Analyze phenotypes under various growth conditions, particularly during stress and developmental states

    • Complement with wild-type and catalytically inactive variants

  • Localization studies:

    • Fluorescent protein fusions to determine subcellular localization

    • Immunolocalization with anti-yheN antibodies

    • Fractionation experiments to confirm membrane association

  • Interaction studies:

    • Pull-down assays to identify protein interaction partners

    • Bacterial two-hybrid systems to confirm direct interactions

    • In vivo crosslinking to capture transient interactions

  • Physiological impact analysis:

    • Growth analysis in minimal media with acetate as carbon source, similar to studies on AcuC and SrtN deacetylases

    • Cell wall analysis to detect structural changes in peptidoglycan composition

    • Stress resistance profiling (osmotic, heat, antibiotic challenges)

How can researchers design mutagenesis studies to probe yheN structure-function relationships?

Strategic mutagenesis approaches include:

  • Catalytic domain mutations:

    • Target conserved residues in the deacetylase catalytic motif

    • Create alanine substitutions of predicted metal-binding residues

    • Design mutations based on homology with characterized deacetylases

  • Transmembrane domain alterations:

    • Truncation constructs to assess membrane anchoring requirements

    • Point mutations in the transmembrane region to affect localization

    • Domain swapping with related deacetylases

  • Functional validation:

    • In vitro enzymatic assays with purified mutant proteins

    • Complementation of ΔyheN phenotypes with mutant variants

    • Structural analysis to confirm mutation effects on protein folding

What control experiments are essential when working with recombinant yheN?

Rigorous experimental design requires appropriate controls:

  • Protein quality controls:

    • Heat-inactivated yheN to distinguish enzymatic from non-enzymatic effects

    • Catalytically inactive mutant (e.g., metal-binding site mutation)

    • Empty vector or irrelevant protein expressed under identical conditions

  • Experimental controls:

    • Wild-type B. subtilis alongside ΔyheN strains

    • Complemented strains to confirm phenotype specificity

    • Related deacetylase enzymes (e.g., AcuC) for comparative analysis

  • Technical controls:

    • No-substrate controls in enzymatic assays

    • Time-course sampling to establish reaction linearity

    • Substrate-only incubations to account for spontaneous deacetylation

How should researchers address potential conflicts in yheN functional data?

When encountering contradictory data about yheN function:

  • Reconcile methodological differences:

    • Examine expression systems used (E. coli vs. native B. subtilis)

    • Compare purification strategies that might affect enzyme activity

    • Analyze buffer compositions and reaction conditions across studies

  • Apply multiple complementary techniques:

    • Combine in vitro biochemical assays with in vivo genetic approaches

    • Use both targeted and global analysis methods (e.g., proteomics, metabolomics)

    • Implement cross-validation with orthogonal detection methods

  • Consider experimental design factors:

    • Apply factorial design principles to systematically test variables

    • Use central composite design to optimize conditions as demonstrated in similar research contexts

    • Ensure proper randomization and blocking to minimize confounding factors

  • Utilize contradiction as a scientific tool:

    • Implement contradiction in natural language inference techniques to challenge hypotheses about protein function

    • Develop alternative models that account for contradictory observations

    • Design critical experiments specifically to resolve contradictions

What case study approaches are most informative for yheN research?

Based on successful case studies in related fields:

  • Comparative case study approach:

    • Study yheN alongside related deacetylases (e.g., AcuC, SrtN) to understand functional overlap and specificity

    • Compare yheN function across different Bacillus species

    • Use theory-oriented case study design for theory extension/refinement

  • Data collection methods:

    • Implement multiple sources: interviews with experts, archival data, and direct observation

    • Create a comprehensive database of experimental results across conditions

    • Maintain rigorous chain of evidence throughout the investigation

  • Analysis techniques:

    • Apply pattern matching to identify consistencies across experiments

    • Use cross-case analysis when comparing multiple yheN variants

    • Implement data reduction techniques through open coding methods

How can researchers integrate structural analysis with functional data for yheN?

Integration strategies include:

  • Structure prediction and validation:

    • Generate homology models based on related deacetylases

    • Validate models with limited proteolysis and circular dichroism

    • Perform molecular dynamics simulations to assess structural stability

  • Structure-guided functional analysis:

    • Map conserved residues onto structural models

    • Design mutations based on predicted catalytic and substrate-binding sites

    • Correlate structural features with experimentally determined kinetic parameters

  • Integrated data visualization:

    • Create structural heat maps of activity data

    • Develop interactive models showing mutation effects on structure and function

    • Implement principal component analysis to identify key structure-function relationships

What bioinformatic approaches can reveal insights about yheN evolution and specificity?

Comprehensive bioinformatic analysis should include:

  • Phylogenetic analysis:

    • Construct phylogenetic trees of deacetylase families

    • Analyze yheN conservation across Bacillus species and related genera

    • Identify evolutionary patterns suggesting functional specialization

  • Genomic context analysis:

    • Examine gene neighborhood conservation

    • Analyze co-evolution patterns with potential interaction partners

    • Identify regulatory elements in the yheN promoter region

  • Substrate prediction:

    • Use docking simulations with potential polysaccharide substrates

    • Analyze conservation of substrate-binding residues

    • Compare with experimentally characterized deacetylases from other species

By employing these comprehensive approaches, researchers can develop a thorough understanding of yheN's structure, function, and biological significance in Bacillus subtilis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.