Recombinant Bacillus subtilis Putative potassium channel protein yugO (yugO)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Putative Potassium Channel Protein yugO (yugO)

Recombinant Bacillus subtilis Putative Potassium Channel Protein yugO, commonly referred to as YugO, is a protein expressed in Bacillus subtilis that is believed to function as a potassium efflux channel . The YugO protein is significant for its role in biofilm formation and potassium homeostasis in B. subtilis . Recombinant YugO is produced using recombinant DNA technology, often in E. coli or yeast, for research purposes .

Gene and Protein Information

FeatureDescription
Gene NameyugO potassium channel protein YugO
Official SymbolYUGO
SynonymsYUGO; potassium channel protein YugO
Gene ID938842
UniProt IDQ795M8
SpeciesBacillus subtilis
SourceE. coli/Yeast
TagHis
Purity> 80% by SDS-PAGE
Endotoxin level< 1.0 EU per μg of protein (LAL method)

Role in Biofilm Formation

YugO, along with MstX, is essential for biofilm development in B. subtilis . Biofilms represent a predominant form of microbial life and can lead to antibiotic resistance in systemic infections . The expression of mstX and yugO is negatively regulated by SinR, a transcription factor that controls the switch between planktonic and sessile states . MstX regulates the activity of Spo0A through a positive autoregulatory loop involving KinC, a histidine kinase activated by potassium leakage . Adding potassium can disrupt MstX-mediated biofilm formation . MstX and YugO participate in a positive feedback loop, influencing KinC and potassium levels to stabilize biofilm assembly .

Potassium Homeostasis

YugO is involved in potassium homeostasis in Bacillus subtilis . Specifically, YugO functions as a potassium efflux channel . c-di-AMP binds to most proteins involved in potassium homeostasis, affecting their activities, with the exception of the sporulation protein YugO .

Mistic and yugO

The Bacillus subtilis protein Mistic interacts with the bacterial membrane and assists in the overexpression of other membrane proteins . A highly conserved Shine-Dalgarno sequence in the mstX-yugO operon is important for the downstream translation of the potassium ion channel YugO .

Functional Studies and Regulation

Mutations in mstX and yugO reduce colony architecture and pellicle formation, which can be rescued by the sinR mutation . MstX negatively regulates parallel antirepressors involved in biofilm formation .

Recombinant Protein Production

Recombinant YugO protein is typically produced with a His-tag for purification purposes . The recombinant protein can be expressed in E. coli or yeast . The protein is available in liquid or lyophilized powder form .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yugO; BSU31322; BSU31320; Putative potassium channel protein YugO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-328
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yugO
Target Protein Sequence
MKSNRIFISWLRWPLFIRIGVIILCLILLFGQIIYILEPKQFTSVFEGIWWAVVTVSTVG YGDYVPHTPLGQAAGILLILSGASFVTAYFATLSAAAFSRQHRYIEGKVAYKGRDHIILI GWNEKTNRLLKDLQLAAPSKTVVLIDESLTEGPLIENVHFIRGHAADDGTLKRANITEAE SVMITADQYKSETDADMLSVLTLLSVKGLNPLAYCIVEILTDRFVTNAERAGANQIIGTS EFISRAMLQHYQVKLRPSKQQNGIKLTLDQHVELLAVPDELKGAAYKTCVLYFLDHNTTI IGIQKKEGPMLSPPLTYKVLETDQFLAI
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the YugO potassium channel protein in Bacillus subtilis?

YugO (UniProt ID: Q795M8) is a potassium channel in B. subtilis that functions as a K+ efflux channel. It is gated intracellularly by a trkA domain that responds to the cell's metabolic state. Research demonstrates that YugO facilitates long-range electrical signals within bacterial biofilm communities through spatially propagating waves of potassium, which coordinate metabolic states among cells in different regions of the biofilm . The protein is essential for biofilm development and plays a key role in bacterial electrical communication systems.

How does the YugO potassium channel contribute to biofilm formation?

YugO, as part of the mstX-yugO operon, is necessary for biofilm development in B. subtilis. Experimental evidence shows that expression of mstX and the downstream yugO is essential for biofilm formation, and overexpression of mstX can induce biofilm assembly . The mechanism involves regulation of Spo0A activity through a positive autoregulatory loop involving KinC, a histidine kinase activated by potassium leakage . This process is sensitive to extracellular potassium levels, as adding potassium has been shown to abrogate mstX-mediated biofilm formation . These findings highlight the importance of potassium homeostasis in bacterial development regulation.

What experimental approaches are used to study YugO function?

Several complementary approaches are employed to investigate YugO function:

Experimental ApproachMethodologyMeasurements
Genetic manipulationCreation of yugO deletion strainsChanges in biofilm formation and potassium efflux
ElectrophysiologyFluorescent membrane potential dyesOscillations in membrane potential
Potassium flux assaysPotassium-sensitive indicators (APG-4)Extracellular potassium levels
Metabolic perturbationNutrient modification (e.g., glutamate withdrawal)Effects on channel activity
Membrane potential clampingHigh extracellular KCl (300 mM)Prevention of net potassium flux
Ionophore applicationsValinomycin treatmentManipulation of potassium permeability

These approaches collectively provide insights into YugO's role in potassium homeostasis and electrical signaling within bacterial communities .

How can one optimize expression and purification of recombinant YugO protein for structural studies?

Optimizing recombinant YugO expression and purification requires careful attention to multiple parameters:

ParameterRecommended ApproachConsiderations
Expression systemE. coli or yeast (as specified in commercial preparations)E. coli for high yield; yeast for complex folding
Protein taggingHis-tag (as used in commercial preparations)Facilitates purification via affinity chromatography
Purification methodMulti-step chromatographyAim for >80% purity by SDS-PAGE
Quality controlEndotoxin assay (LAL method)Maintain <1.0 EU per μg protein
Storage conditions-20°C to -80°C for long-termUse PBS buffer for stability

When expressing membrane proteins like YugO, additional considerations include proper detergent selection for solubilization and maintaining protein stability throughout the purification process. Commercial preparations of recombinant YugO protein are available in both liquid and lyophilized forms, with established protocols for handling and storage .

How does the trkA domain regulate YugO channel gating in response to metabolic states?

The trkA domain of YugO serves as an intracellular regulatory module that couples metabolic sensing to channel gating. Current research indicates a complex regulatory mechanism:

The trkA domain is regulated by the metabolic state of the cell, likely responding to changes in intracellular nucleotide ratios or redox conditions . When glutamate (the sole nitrogen source in experimental media) is withdrawn, wild-type B. subtilis shows an increase in extracellular potassium, indicating channel activation . This response is abolished in yugO deletion strains, confirming the channel's role in this process .

The metabolic regulation creates a positive feedback loop where:

  • Metabolic triggers induce release of intracellular potassium

  • This potassium release depolarizes neighboring cells

  • The wave of depolarization propagates through the biofilm

  • This electrical signal coordinates metabolic states across the bacterial community

This sophisticated regulatory mechanism allows bacterial communities to synchronize their metabolic activities through electrical communication mediated by the YugO channel .

What is the role of YugO-mediated electrical signaling in coordinating bacterial community behaviors?

YugO-mediated electrical signaling represents a sophisticated coordination mechanism in bacterial communities:

The YugO potassium channel conducts long-range electrical signals within bacterial biofilm communities through spatially propagating waves of potassium . These signals result from a positive feedback loop where metabolic triggers induce potassium release, which then depolarizes neighboring cells . This electrical communication system coordinates metabolic states among cells in different regions of the biofilm.

Experimental evidence demonstrates that:

  • Deletion of the potassium channel abolishes this response

  • Spatial propagation can be hindered by specific genetic perturbations to potassium channel gating

  • Clamping potassium flux (using 300 mM KCl to match intracellular concentrations) immediately halts oscillations in membrane potential

Unlike potassium, sodium shows no oscillations, confirming the specific role of potassium channels in this signaling system . This represents a prokaryotic paradigm for active, long-range electrical signaling in cellular communities, with potential parallels to neuronal communication in higher organisms.

What are the key considerations for designing YugO mutants to study channel gating?

Designing YugO mutants requires strategic targeting of functionally relevant domains:

DomainFunctionMutation StrategyExpected Outcome
Pore regionK+ selectivityConservative substitutionsAltered ion selectivity
trkA domainMetabolic sensingAlanine scanningIdentified residues critical for sensing
Transmembrane segmentsChannel opening/closingCysteine substitutionMapped conformational changes
InterfacesSubunit interactionsDomain swappingDetermined assembly requirements

When designing mutants, researchers should consider:

  • Structural modeling based on homologous potassium channels

  • Conservation analysis to identify functionally important residues

  • Introduction of mutations that allow specific functional assays (e.g., disulfide crosslinking)

  • Paired mutations to test interaction hypotheses

Each mutant should be tested in both in vitro systems (purified protein) and cellular contexts (complementation of yugO deletion strains) to fully understand the functional impact of the mutation .

How can the electrical signaling properties of YugO be measured in intact biofilms?

Measuring electrical signaling in intact biofilms requires specialized techniques:

TechniqueMeasurementAdvantageChallenge
Voltage-sensitive dyesMembrane potential changesSpatial resolutionDye penetration into biofilm
Potassium-selective microelectrodesLocal K+ concentrationDirect measurementPotential biofilm disruption
Genetic voltage indicatorsCell-specific potentialNon-invasiveRequires genetic modification
Microelectrode arraysMulti-site recordingTemporal precisionSurface contact limitations

When glutamate (the sole nitrogen source) is withdrawn from the media, researchers can observe an increase in extracellular potassium in wild-type strains but not in yugO deletion strains, confirming channel activity . To directly test whether membrane potential oscillations are driven by potassium flux, researchers can clamp the net potassium flux by supplementing growth media with 300 mM KCl (matching intracellular K+ concentration), which abruptly halts oscillations in membrane potential .

Combined approaches provide the most comprehensive picture of electrical signaling dynamics in these complex bacterial communities.

How should researchers address data contradictions when studying YugO channel function?

When faced with contradictory data regarding YugO function, researchers should employ a systematic approach:

  • Methodological comparison: Carefully examine differences in experimental conditions, including:

    • Growth media composition (particularly potassium and nitrogen sources)

    • Biofilm growth conditions (surface, temperature, humidity)

    • Measurement techniques and their temporal/spatial resolution

  • Strain verification: Confirm genetic background of strains used, as:

    • Laboratory strains may accumulate mutations affecting channel function

    • Different B. subtilis isolates may show variable phenotypes

    • Unintended mutations may affect regulatory systems

  • Contextual analysis: Consider how environmental factors influence results:

    • Biofilm maturity stage may affect electrical signaling patterns

    • Population density can influence communication network properties

    • Nutrient availability affects metabolic state and trkA domain regulation

  • Integration framework: Develop models that accommodate seemingly contradictory results by considering YugO function as state-dependent rather than fixed.

This approach recognizes that contradictions often reflect real biological complexity rather than experimental error, potentially leading to deeper insights about context-dependent channel function .

What analytical approaches are most appropriate for quantifying YugO-mediated electrical signaling?

Quantifying YugO-mediated electrical signaling requires specialized analytical approaches:

Analysis TypeMethodApplication
Temporal dynamicsFourier analysisIdentifying oscillation frequencies
Spatial patternsCorrelation analysisMeasuring signal propagation
Signal propagationWavefront velocity calculationDetermining communication speed
Statistical verificationMixed-effects modelsAccounting for biofilm heterogeneity

When analyzing extracellular potassium measurements, researchers should:

  • Account for baseline drift using appropriate normalization

  • Apply moving window analyses to capture dynamic changes

  • Correlate potassium flux with metabolic indicators

  • Compare wild-type and yugO deletion strains under identical conditions

For membrane potential data, proper quantification includes measuring amplitude, frequency, and propagation velocity of oscillations, with direct comparison to controls where potassium flux is clamped using high extracellular KCl (300 mM) .

How might studying YugO channel function advance our understanding of bacterial communication systems?

YugO research provides insights into a previously underappreciated mode of bacterial communication:

Research AreaPotential AdvanceSignificance
Multicellular coordinationElectrical signaling networksParadigm shift from chemical to electrical communication
Biofilm physiologyMetabolic synchronization mechanismsNew understanding of community resource allocation
Evolutionary biologyAncient origins of electrical signalingConnection between bacterial and neuronal communication
Antimicrobial strategiesNovel antibiofilm targetsPotential to disrupt bacterial communication

While chemical communication (quorum sensing) operates on timescales of minutes to hours, YugO-mediated electrical signaling can transmit information on millisecond-to-second timescales, representing a distinct temporal domain of bacterial communication . This system allows spatially separated cells to coordinate their activities rapidly, which may be particularly important during environmental stress responses.

Future studies should investigate potential interactions between electrical and chemical signaling systems, as these likely form an integrated communication network rather than operating independently.

What technical innovations could enhance our ability to study YugO and similar ion channels?

Advancing YugO research will benefit from several technical innovations:

InnovationApplicationAdvantage
Cryo-EM structural studiesHigh-resolution channel structureUnderstanding of gating mechanism
Single-molecule techniquesReal-time conformational dynamicsDirect observation of channel opening
Microfabricated biofilm chambersControlled electrical measurementsPrecise manipulation of environmental conditions
Optogenetic channel controlSpatiotemporal activationProbing causal relationships in signaling

Development of recombinant YugO with site-specific labels or sensors could enable direct monitoring of channel activity and conformational changes. Commercial availability of purified recombinant YugO protein (>80% purity by SDS-PAGE) provides a starting point for such modifications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.