Recombinant Bacillus subtilis Putative PTS system glucosamine-specific EIICBA component (gamP)

Shipped with Ice Packs
In Stock

Description

Overview of the Compound

The recombinant Bacillus subtilis Putative PTS system glucosamine-specific EIICBA component (gamP) is a recombinant protein derived from the gamP gene (BSU_02350) in B. subtilis. It functions as part of the phosphoenolpyruvate (PEP)-dependent phosphotransferase system (PTS), specifically mediating the uptake and phosphorylation of glucosamine. The protein contains four functional domains: EIIC (transmembrane channel), EIIB (phosphorylation domain), EIIA (phosphocarrier), and a permease component, enabling both transport and metabolic processing of glucosamine .

2.2. Functional Domains and Mechanism

  • EIIC Domain: Forms the transmembrane channel for glucosamine entry.

  • EIIB Domain: Phosphorylates glucosamine using a phosphohistidine intermediate.

  • EIIA Domain: Transfers phosphoryl groups from HPr to EIIB.

  • Permease Component: Facilitates substrate translocation across the membrane .

This structure enables simultaneous transport and phosphorylation of glucosamine, bypassing the need for separate enzymes .

3.1. Glucosamine Utilization

GamP is part of the gamAP operon, which is strongly induced by glucosamine. It works in conjunction with:

  • GamA: Glucosamine-6-phosphate deaminase (catalyzes conversion to fructose-6-phosphate).

  • NagP: N-acetylglucosamine-specific transporter (handles GlcNAc) .

Key Findings:

  • Growth Efficiency: B. subtilis grows faster on glucosamine than N-acetylglucosamine due to the gamAP operon .

  • Redundancy: PtsG (glucose transporter) also facilitates glucosamine uptake, though less efficiently than GamP .

3.2. Cross-Talk with Other PTS Transporters

GamP interacts with other PTS components, such as PtsG and YpqE, to enable phosphorylation of EIIA-deficient transporters (e.g., MalP, NagP). This cross-talk is critical for nutrient sensing and metabolic regulation .

4.1. Expression and Purification

ParameterDetail
Host OrganismE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE confirmed)
Storage-20°C/-80°C (lyophilized); avoid repeated freeze-thaw cycles .

Applications:

  • SDS-PAGE Analysis: Used to validate protein integrity and purity.

  • Functional Studies: Investigate PTS-mediated transport and phosphorylation mechanisms.

4.2. Research Significance

  • Metabolic Flexibility: GamP’s dual role in transport and phosphorylation highlights B. subtilis’ ability to adapt to fluctuating nutrient environments .

  • Therapeutic Potential: Insights into PTS systems could inform antibiotic resistance strategies or metabolic engineering in biotechnology .

5.1. Growth Phenotypes in B. subtilis

StrainGlucosamine Growth RateN-Acetylglucosamine Growth Rate
Wild TypeRapidSlower
ΔgamPDelayedUnaffected
ΔgamAPSeverely impairedUnaffected

Source:

5.2. Biochemical Interactions

GamP’s EIIA domain phosphorylates EIIB components of other PTS transporters (e.g., MalP, NagP), enabling cross-talk between carbohydrate utilization systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your application.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer components, temperature, and protein stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
gamP; ybfS; yzfA; BSU02350; Putative PTS system glucosamine-specific EIICBA component [Includes: Glucosamine permease IIC component; PTS system glucosamine-specific EIIC component; Glucosamine-specific phosphotransferase enzyme IIB component; PTS system glucosamine-specific EIIB component; Glucosamine-specific phosphotransferase enzyme IIA component; PTS system glucosamine-specific EIIA component]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-631
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
gamP
Target Protein Sequence
MFKKAFQILQQLGRALMTPVAVLPAAGLLLRFGDKDLLNIPIIKDAGGVVFDNLPLIFAV GVAIGLAGGEGVAGLAAVIGYLILTVTLDNMGKLLGLQPPYEGAEHLIDMGVFGGIIIGL LAAYLYKRFSSIELHPVLGFFSGKRFVPIITSVSSLVIGVIFSFVWPLIQNGINAASSLI ADSTVGLFFYATIYRLLIPFGLHHIFYTPFYFMMGEYTDPSTGNTVTGDLTRFFAGDPTA GRFMMGDFPYMIFCLPAVALAIIHTARPEKKKMISGVMISAALTSMLTGITEPVEFSFLF VAPVLYLINSILAGVIFVVCDLFHVRHGYTFSGGGIDYVLNYGLSTNGWVVIPVGIVFAF IYYYLFRFAILKWNLKTPGRETDEDGQNEEKAPVAKDQLAFHVLQALGGQQNIANLDACI TRLRVTVHQPSQVCKDELKRLGAVGVLEVNNNFQAIFGTKSDALKDDIKTIMAGGVPATA AALDTVTDKPLKPDSDETFIYPIKGETVSLGDVPDQVFSEKMMGEGFAIIPSEGKVVAPA DGEIVSIFPTKHAIGFMSAGGTEILIHVGIDTVKLNGEGFEAHVTSGQAVKQGELLLTFD LNYIKQHAASAITPVIFTNTSEEDLKHIQMK
Uniprot No.

Target Background

Function
The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a primary carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates simultaneously with their translocation across the cell membrane. This system may be involved in glucosamine transport.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the gamP gene and what role does it play in B. subtilis metabolism?

The gamP gene encodes a putative PTS system glucosamine-specific EIICBA component that is essential for efficient glucosamine transport in Bacillus subtilis. It forms part of the gamAP operon, which encodes proteins specifically involved in glucosamine uptake and catabolism. This specialized transport system contributes to B. subtilis' ability to grow more rapidly using glucosamine as a carbon source compared to N-acetylglucosamine . Unlike the more widely distributed nagAB-yvoA system found throughout Firmicutes, the gamAP operon appears to be unique to B. subtilis and closely related species, suggesting it may be an evolutionarily recent acquisition that provides a metabolic advantage .

How does the gamP-encoded transporter differ structurally from other PTS transporters?

The gamP gene encodes a complete EIICBA component, containing all three functional domains required for PTS transport in a single polypeptide chain. This differs from some bacterial PTS systems where these domains are encoded by separate genes. The EIIC domain forms the transmembrane channel for glucosamine transport, while the EIIB domain is involved in phosphoryl transfer, and the EIIA domain interacts with the general PTS proteins. Comparative analysis with the E. coli NagE protein (which also encodes a complete EIICBA component) reveals structural similarities, though the B. subtilis gamP product demonstrates higher specificity for glucosamine over N-acetylglucosamine .

What is the regulatory mechanism controlling gamP expression?

The gamAP operon is under negative regulation by YbgA, a GntR family transcriptional repressor. The ybgA gene is expressed divergently from the gamAP operon, creating a classic regulatory arrangement where the repressor gene is adjacent to the genes it controls. Unlike the nagAB-yvoA regulatory system (where YvoA/NagR functions as the repressor), the ybgA-gamAP system is strongly induced specifically by glucosamine. This differential regulation explains why B. subtilis exhibits faster growth on glucosamine compared to N-acetylglucosamine, as the presence of glucosamine derepresses the gamAP operon, allowing for efficient transport and metabolism of this amino sugar .

What are the optimal conditions for expressing recombinant gamP in laboratory settings?

For successful expression of recombinant gamP, researchers should consider:

  • Expression System Selection: E. coli BL21(DE3) or B. subtilis expression systems (WB800 strain) are recommended, with the latter being preferred for proper folding of membrane proteins.

  • Induction Parameters: For IPTG-inducible systems, use 0.1-0.5 mM IPTG at lower temperatures (16-25°C) for 4-16 hours to enhance proper folding of this membrane protein.

  • Growth Media Optimization: M9 minimal media supplemented with 0.4% glucose or LB media with reduced salt concentration improves expression yields.

  • Solubilization Conditions: Use mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1-2% for membrane extraction, followed by affinity purification.

The addition of 0.1-0.5% glucosamine to the growth medium can enhance expression through natural regulatory mechanisms, though this should be tested empirically for each expression system .

What methods are most effective for studying gamP transport activity in vitro?

To effectively study gamP transport activity:

  • Reconstitution in Proteoliposomes:

    • Purify recombinant gamP using affinity chromatography

    • Reconstitute in liposomes composed of E. coli polar lipids and phosphatidylcholine (3:1 ratio)

    • Perform transport assays using radiolabeled [14C]-glucosamine

  • PTS-dependent Phosphorylation Assay:

    • Combine purified gamP with general PTS components (EI, HPr)

    • Measure phosphorylation rates using 32P-PEP as phosphoryl donor

    • Assess substrate specificity by comparing uptake rates of different sugars

  • Whole-Cell Transport Assays:

    • Use B. subtilis strains with defined mutations in sugar transport systems

    • Compare transport kinetics between wild-type and gamP deletion mutants

    • Determine Km and Vmax values for different amino sugars

These methodologies can help distinguish between true transport activity and non-specific binding or diffusion events .

How can researchers generate and validate gamP deletion mutants?

For effective generation and validation of gamP deletion mutants:

  • Deletion Construction:

    • Utilize excisable spectinomycin resistance cassette method as described in the literature

    • Design primers with 20-25 bp homology to flanking regions of gamP

    • Perform PCR amplification of the resistance cassette with these primers

    • Transform B. subtilis with the amplified product and select on spectinomycin media

  • Validation Methods:

    • PCR verification using primers outside the deletion region

    • Whole-genome sequencing to confirm clean deletion without off-target effects

    • Complementation studies using ectopic expression of gamP to restore phenotype

    • Growth curve analysis on media with glucosamine as sole carbon source

  • Phenotypic Confirmation:

    • Compare growth rates on different carbon sources (specifically glucosamine vs. N-acetylglucosamine)

    • Measure uptake of radiolabeled glucosamine

    • Perform metabolic profiling to assess changes in intracellular metabolite concentrations

How does the amino acid sequence of gamP influence its substrate specificity compared to other PTS transporters?

The substrate specificity of gamP is determined by critical amino acid residues in its EIIC domain that form the sugar-binding pocket. Research suggests several key structural features:

  • Binding Pocket Architecture: The EIIC domain of gamP contains a distinctive arrangement of polar and charged residues that preferentially accommodate glucosamine over N-acetylglucosamine. Specifically, key residues in transmembrane helices 4, 7, and 10 create a specialized binding environment that recognizes the unacetylated amino group of glucosamine.

  • Critical Residues for Specificity:

    • Conserved aspartate residues in TM7 and TM10 form hydrogen bonds with the C2 amino group of glucosamine

    • A smaller hydrophobic pocket compared to NagE cannot easily accommodate the acetyl group of N-acetylglucosamine

    • Conserved tryptophan residues contribute to sugar ring orientation through π-interactions

  • Domain Interactions: The interaction between the EIIC and EIIB domains affects not only transport but also specificity, as mutations at this interface can alter substrate preference.

Site-directed mutagenesis targeting these key residues, followed by transport assays with different substrates, provides experimental validation of their roles in determining specificity .

What is the evolutionary significance of the unique distribution of the gamAP operon in B. subtilis?

The evolutionary significance of the gamAP operon's restricted distribution:

  • Genomic Context Analysis: The ybgA-gamAP synton (including the ybgB gene) is found only in B. subtilis and very close relatives, contrasting with the widely distributed nagAB-yvoA synton present throughout Firmicutes. Genomic context analysis reveals that the gamAP operon is flanked by genes with different phylogenetic profiles, suggesting acquisition through horizontal gene transfer.

  • Selective Advantage: The presence of gamAP confers a significant growth advantage when glucosamine is the primary carbon source. This suggests that the acquisition and maintenance of this operon responded to specific environmental pressures where efficient glucosamine utilization provided a fitness benefit.

  • Regulatory Integration: The gamAP operon has established a sophisticated regulatory system with the divergently transcribed ybgA repressor, indicating evolutionary refinement of its control mechanisms to respond specifically to glucosamine.

  • Metabolic Redundancy and Specialization: While B. subtilis possesses two systems for amino sugar utilization (nag and gam), they have evolved distinct specificities and regulatory mechanisms, representing a case of functional refinement rather than simple redundancy. This specialization allows B. subtilis to efficiently utilize both glucosamine and N-acetylglucosamine under different environmental conditions .

How does the three-dimensional structure of gamP facilitate its transport function?

Although a high-resolution structure of gamP is not yet available, computational modeling and comparative analysis with related PTS transporters suggest:

Future research using cryo-EM or X-ray crystallography would provide definitive structural insights into this transport mechanism .

How does the functionality of gamP compare with nagP in B. subtilis?

Comparative analysis between gamP and nagP reveals important functional distinctions:

FeaturegamP (PTS GlcN-specific EIICBA)nagP (PTS GlcNAc-specific EIICBA)
Primary substrateGlucosamine (GlcN)N-acetylglucosamine (GlcNAc)
Transport efficiencyHigher for GlcNHigher for GlcNAc
Expression regulationRepressed by YbgA, induced by GlcNRepressed by YvoA (NagR), induced by GlcNAc
Genomic distributionLimited to B. subtilis and close relativesWidely distributed across Bacilli
Contribution to growthMajor contributor to growth on GlcNMajor contributor to growth on GlcNAc
Phosphorylation siteConserved histidine in EIIB domainConserved histidine in EIIB domain
Substrate specificityNarrow (primarily GlcN)Broader (accepts GlcNAc and at lower rates GlcN)

What metabolic pathways interact with gamP-mediated glucosamine transport?

The gamP-mediated glucosamine transport system interfaces with multiple metabolic pathways:

  • Direct Downstream Metabolism:

    • Transported glucosamine is phosphorylated to glucosamine-6-phosphate during PTS-mediated uptake

    • Glucosamine-6-phosphate is deaminated by GamA (or to a lesser extent NagB) to form fructose-6-phosphate

    • Fructose-6-phosphate enters glycolysis, linking amino sugar metabolism to central carbon metabolism

  • Nitrogen Metabolism:

    • The deamination of glucosamine-6-phosphate releases ammonia

    • This ammonia can be assimilated through glutamine synthetase and glutamate synthase

    • This process contributes to nitrogen metabolism, providing a source of nitrogen for amino acid biosynthesis

  • Cell Wall Biosynthesis:

    • Glucosamine-6-phosphate can be directed toward peptidoglycan synthesis

    • This occurs through conversion to UDP-N-acetylglucosamine via a pathway involving GlmS, GlmM, and GlmU enzymes

    • This alternative fate links gamP activity to cell wall formation and remodeling

  • Regulatory Cross-talk:

    • Carbon catabolite repression influences gamP expression through CcpA-mediated regulation

    • Nutrient limitation stress responses modulate amino sugar utilization

    • Cell envelope stress response systems interact with pathways dependent on amino sugar metabolism

These interactions highlight the integrated nature of gamP function within the broader metabolic network of B. subtilis .

How does phosphorylation status affect the structure-function relationship of gamP?

The phosphorylation status of gamP profoundly influences its structure and function:

How can recombinant gamP be utilized as a tool for metabolic engineering?

Recombinant gamP offers several innovative applications in metabolic engineering:

  • Enhanced Amino Sugar Uptake:

    • Heterologous expression of gamP in industrial strains can improve glucosamine uptake efficiency

    • Engineering gamP variants with altered kinetic properties can optimize flux through desired metabolic pathways

    • Co-expression with gamA can create a complete pathway for efficient conversion of glucosamine to central metabolites

  • Biosensor Development:

    • gamP can be coupled with reporter systems to create biosensors for glucosamine

    • Such biosensors could monitor fermentation processes or screen for mutants with enhanced glucosamine production

    • By linking glucosamine transport to fluorescent protein expression, high-throughput screening becomes possible

  • Metabolic Pathway Optimization:

    • Strategic manipulation of gamP expression can direct carbon flux toward valuable products

    • Fine-tuning the balance between gamP and nagP systems can optimize utilization of mixed amino sugar feedstocks

    • Integration with synthetic biology approaches can create switch-like behaviors in response to different carbon sources

  • Protein Engineering Targets:

    • Structure-guided engineering of gamP could expand its substrate range to include non-natural amino sugars

    • Creation of chimeric transporters combining domains from different PTS systems might yield novel specificities

    • Directed evolution approaches could develop gamP variants with enhanced stability or activity .

What are the most significant unresolved questions regarding gamP function and regulation?

Critical unresolved questions that merit further investigation:

  • Structural Determinants of Specificity:

    • What is the precise atomic structure of gamP, particularly its substrate-binding pocket?

    • Which specific residues determine the preference for glucosamine over N-acetylglucosamine?

    • How do conformational changes during the transport cycle affect substrate selectivity?

  • Regulatory Mechanisms:

    • What are the molecular details of YbgA interaction with the gamAP promoter region?

    • How do global regulatory systems (like carbon catabolite repression) integrate with specific regulation by YbgA?

    • Are there additional regulatory mechanisms beyond transcriptional control that modulate gamP activity?

  • Evolutionary Origin:

    • What is the exact evolutionary origin of the gamAP operon in B. subtilis?

    • What selective pressures drove the acquisition and maintenance of this specialized system?

    • How did the regulatory mechanism involving YbgA co-evolve with the gamAP operon?

  • Integration with Cellular Physiology:

    • How does gamP activity influence broader aspects of B. subtilis physiology beyond carbon utilization?

    • What is the significance of the metabolic redundancy provided by having both nag and gam systems?

    • How does the cell balance the allocation of transported glucosamine between energy production and cell wall biosynthesis?

What novel experimental approaches could advance our understanding of gamP structure and function?

Innovative experimental approaches to further elucidate gamP biology:

  • Advanced Structural Biology Techniques:

    • Cryo-electron microscopy to resolve the three-dimensional structure of gamP in different conformational states

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during the transport cycle

    • Solid-state NMR to study gamP dynamics in a native-like membrane environment

  • Single-Molecule Methods:

    • Single-molecule FRET to track conformational changes during substrate binding and transport

    • Atomic force microscopy to measure forces associated with substrate translocation

    • Single-cell microfluidics to analyze heterogeneity in gamP expression and activity

  • Systems Biology Approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) to map the impact of gamP on global cellular state

    • Flux balance analysis to quantify metabolic rewiring in response to gamP activity

    • Network analysis to identify non-obvious functional connections between gamP and other cellular processes

  • Synthetic Biology Tools:

    • CRISPR interference for precise modulation of gamP expression

    • Optogenetic control of gamP to study temporal aspects of its function

    • Minimal cell approaches to define the essential components required for gamP functionality

  • Computational Methods:

    • Molecular dynamics simulations to model substrate translocation through the gamP channel

    • Machine learning approaches to predict substrate specificity based on sequence features

    • Evolutionary sequence analysis to identify co-evolving residues critical for function

What are common challenges in expressing and purifying functional recombinant gamP?

Researchers frequently encounter these challenges when working with recombinant gamP:

  • Expression Challenges:

    • Toxicity when overexpressed (Solution: Use tightly regulated inducible systems and lower induction temperatures)

    • Inclusion body formation (Solution: Express as fusion with solubility tags like MBP or utilize specialized strains)

    • Low yield (Solution: Optimize codon usage for expression host and consider specialized cell-free expression systems)

  • Purification Difficulties:

    • Detergent selection is critical (Solution: Screen multiple detergents; DDM, LMNG, and GDN often work well)

    • Loss of activity during purification (Solution: Include substrate and stabilizing lipids throughout purification)

    • Aggregation during concentration (Solution: Add glycerol or use specialized concentration devices designed for membrane proteins)

  • Functional Assessment:

    • Distinguishing between active and inactive protein (Solution: Develop activity assays early in the purification process)

    • Reconstituting proper orientation in proteoliposomes (Solution: Control reconstitution pH and detergent removal rate)

    • Accounting for background transport (Solution: Use appropriate negative controls lacking key catalytic residues)

  • Storage Stability:

    • Activity loss during storage (Solution: Flash-freeze in small aliquots with cryoprotectants)

    • Long-term stability issues (Solution: Identify stabilizing conditions through thermal shift assays)

    • Batch-to-batch variability (Solution: Develop robust quality control metrics for each preparation) .

How can researchers differentiate the specific contributions of gamP versus nagP in amino sugar metabolism?

To distinguish between gamP and nagP contributions:

  • Genetic Approaches:

    • Create single and double deletion mutants (ΔgamP, ΔnagP, ΔgamP/ΔnagP)

    • Construct complementation strains with controlled expression of each transporter

    • Utilize promoter swapping to express each gene under the other's regulatory control

  • Biochemical Differentiation:

    • Perform transport assays with radiolabeled substrates at varying concentrations to determine kinetic parameters

    • Use competitive inhibition studies with substrate analogs to probe specificity differences

    • Analyze metabolic profiles of mutant strains grown on different amino sugars

  • Expression Analysis:

    • Employ fluorescent protein fusions to monitor expression dynamics under different conditions

    • Use quantitative proteomics to measure actual transporter levels in the membrane

    • Perform chromatin immunoprecipitation to analyze regulatory protein binding at promoter regions

  • Substrate Specificity Determination:

    • Test transport efficiency with a panel of structurally related sugars

    • Analyze growth phenotypes on different carbon sources

    • Measure intracellular accumulation of phosphorylated intermediates

These approaches in combination provide a comprehensive view of the distinct functional roles of these transporters .

What controls and validations are essential when studying recombinant gamP function?

Essential controls and validations for gamP functional studies:

  • Expression Validation:

    • Western blotting with tag-specific or gamP-specific antibodies

    • Mass spectrometry confirmation of protein identity

    • Blue native PAGE to assess oligomeric state

  • Functional Controls:

    • Catalytically inactive mutants (H→A substitution in phosphorylation site)

    • Heat-inactivated protein preparations

    • Competition assays with excess unlabeled substrate to demonstrate specificity

  • System Validation:

    • Kinetic parameters should match physiologically relevant substrate concentrations

    • Temperature and pH dependence should align with B. subtilis growth conditions

    • Activity should be dependent on general PTS components (EI and HPr)

  • Reconstitution Quality Controls:

    • Liposome size distribution analysis

    • Protein orientation determination using protease protection assays

    • Measurement of internal volume using impermeable markers

  • Specificity Validation:

    • Transport assays with structurally related non-substrate molecules

    • Comparison with other characterized PTS transporters

    • Correlation between in vitro and in vivo activity measurements

Implementing these controls ensures that observed activities genuinely reflect gamP function rather than experimental artifacts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.