Recombinant Bacillus subtilis Putative rhomboid protease ydcA (ydcA)

Shipped with Ice Packs
In Stock

Description

Overview of Bacillus subtilis and Its Proteolytic Systems

Bacillus subtilis serves as a paradigm for Gram-positive endospore-forming bacteria and has been extensively studied through comprehensive genome sequencing and annotation efforts. The SubtiList database represents the reference resource for the B. subtilis 168 genome, providing curated datasets of DNA and protein sequences with relevant annotations and functional assignments . This organism employs sophisticated proteolytic systems that contribute to various cellular processes including protein quality control, stress responses, and developmental transitions.

Proteases in B. subtilis perform diverse functions broadly categorized into processing, regulation, and nutritional roles. These enzymes are strategically distributed throughout cellular compartments—cytoplasm, membrane, cell wall, and extracellular environment—where they contribute to proteostasis through selective degradation of damaged, misfolded, or temporally regulated proteins . The coordinated activities of these proteases ensure cellular homeostasis and facilitate adaptations to changing environmental conditions.

General Characteristics of Rhomboid Proteases

Rhomboid proteases constitute a conserved family of intramembrane serine proteases that cleave substrate proteins within their transmembrane domains. These unique enzymes perform proteolysis within the hydrophobic environment of the lipid bilayer, representing important regulatory mechanisms for membrane protein function and signaling pathways. Unlike conventional proteases that operate in aqueous environments, rhomboid proteases have evolved specialized catalytic mechanisms suitable for hydrolytic reactions within membrane-embedded substrates.

Rhomboid Proteases in Bacillus subtilis

The Bacillus subtilis genome encodes two rhomboid protease genes: ydcA and yqgP (also known as gluP). These intramembrane proteases potentially contribute to the bacterium's adaptive responses through selective proteolysis of membrane proteins . While YqgP has been established as a functionally active rhomboid protease, the biological role and enzymatic activity of YdcA remain largely uncharacterized, representing a significant gap in our understanding of B. subtilis membrane proteostasis.

Genetic Context and Conservation

The ydcA gene encodes a putative rhomboid protease in Bacillus subtilis. Despite its identification as a rhomboid protease gene, experimental investigations have thus far failed to detect proteolytic activity for the YdcA protein . This lack of demonstrable activity contrasts with YqgP, which has been established as a functionally active rhomboid protease capable of cleaving various synthetic substrates and identified natural targets.

Functional Studies of YdcA

Current research indicates that YdcA does not significantly influence the phenotypic behavior of B. subtilis. Gene deletion experiments have demonstrated that the absence of ydcA does not modify the phenotypic characteristics of B. subtilis, regardless of the presence or absence of the yqgP gene . This observation suggests potential functional redundancy or specialized roles that may become apparent only under specific environmental or developmental conditions not typically examined in laboratory settings.

Functional Divergence Between Bacterial Rhomboid Proteases

While both YdcA and YqgP belong to the rhomboid protease family in B. subtilis, their functional profiles differ substantially. YqgP serves as a commonly used model rhomboid protease with demonstrated activity against various synthetic substrates . In contrast, no proteolytic activity has been detected for YdcA in standard experimental assays, suggesting potential divergence in substrate specificity, activation mechanisms, or cellular roles.

YqgP: The Better Characterized Rhomboid Protease

Research has established that YqgP interacts with the membrane-bound ATP-dependent processive metalloprotease FtsH and cleaves MgtE, the major high-affinity magnesium transporter in B. subtilis . This proteolytic activity is enhanced under conditions of low magnesium combined with high manganese or zinc concentrations, suggesting a protective role against metal toxicity. The cleavage of MgtE by YqgP can be inhibited by rhomboid-specific peptidyl ketoamide inhibitors at nanomolar concentrations, confirming the rhomboid-specific nature of this proteolytic event .

Deletion of the yqgP gene results in increased sensitivity to manganese toxicity, which can be rescued through ectopic expression of YqgP . This phenotype demonstrates the biological significance of YqgP in metal homeostasis and cellular protection against metal-induced stress.

Recombinant Expression Systems

The production of recombinant YdcA represents a challenging but essential approach to characterizing this putative rhomboid protease. Expression systems optimized for membrane proteins must accommodate the hydrophobic nature of rhomboid proteases while ensuring proper folding and insertion into membrane environments. Heterologous expression in E. coli or homologous expression in B. subtilis may yield sufficient quantities of recombinant YdcA for biochemical and structural analyses.

Biochemical Characterization Challenges

The apparent lack of proteolytic activity in standard assays poses significant challenges for YdcA characterization. Alternative approaches may include:

  1. Expanded substrate screening to identify potential natural or synthetic substrates

  2. Investigation of potential cofactors or activating conditions

  3. Examination of potential non-proteolytic functions

Protein Quality Control

While no specific proteolytic activity has been detected for YdcA, its classification as a rhomboid protease suggests potential involvement in membrane protein quality control. B. subtilis employs various proteases for maintaining proteostasis, including HtrA-like serine proteases (HtrA, HtrB, HtrC) that scan secretory proteins at the membrane/wall interface for structural authenticity . YdcA might contribute to specialized aspects of this quality control system under specific conditions not yet examined.

Comparison with Other B. subtilis Proteases

B. subtilis employs diverse proteolytic systems for protein quality control, including the Clp proteases (ClpXP, ClpCP) that degrade misfolded or damaged proteins . The ribosome-associated protein quality control (RQC) pathway represents another proteolytic mechanism involving RqcH and YabO components that detect incomplete peptides and target them for degradation . Understanding YdcA's potential relationship with these established proteolytic pathways may provide insights into its biological role.

Critical Knowledge Gaps

Several fundamental questions regarding YdcA remain unanswered:

  1. Does YdcA possess proteolytic activity under specific conditions not yet tested?

  2. What are the natural substrates of YdcA, if any?

  3. Does YdcA contribute to B. subtilis physiology under specialized environmental conditions?

  4. What structural features distinguish YdcA from the catalytically active YqgP?

Recommended Research Approaches

Future investigations should focus on:

  1. Comprehensive substrate screening under diverse environmental conditions

  2. Structural analysis through crystallography or cryo-electron microscopy

  3. Transcriptional profiling to identify conditions that induce ydcA expression

  4. Phenotypic characterization of ydcA mutants under stress conditions

Comparative Analysis of B. subtilis Rhomboid Proteases

Table 1: Comparative Analysis of YdcA and YqgP Rhomboid Proteases in Bacillus subtilis

FeatureYdcAYqgP (GluP)
Demonstrated proteolytic activityNot detected Confirmed against synthetic substrates and natural targets
Known substratesNone identifiedMgtE (magnesium transporter)
Protein interactionsUnknownInteracts with FtsH metalloprotease
Regulatory conditionsUnknownActivity potentiated by low magnesium and high manganese/zinc
Phenotypic impact of gene deletionNo significant phenotypic change Increased sensitivity to manganese toxicity
Model system statusPoorly characterizedCommonly used model rhomboid protease

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ydcA; BSU04610; Putative rhomboid protease YdcA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ydcA
Target Protein Sequence
MFIRTENFQTFIRLYPVVTFILALQAVLWLFFSLPAHSVVLWRDTVTGYNLGVANGEWWR LITPILLHAGFTHLLFNSMSIFLFAPALERMLGKARFLLVYAGSGIIGNIGTYVTEPLDY VHVGASGAIFGLFGVYLFMVLFRNELIGQEHSKMIITLLAFAVLMSFINSNINMMAHLFG LCGGFLLSFLCVQKKERRY
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ydcA and how does it relate to other rhomboid proteases in Bacillus subtilis?

The Bacillus subtilis genome encodes two rhomboid protease genes: ydcA and yqgP (also known as gluP). Both belong to the rhomboid protease family, which are intramembrane serine proteases that cleave substrate proteins within their transmembrane domains. While yqgP has demonstrated proteolytic activity against multiple substrates and serves as a commonly used model rhomboid protease, no proteolytic activity has been detected for YdcA in experimental studies conducted to date . This functional distinction is significant, as it suggests either highly specific substrate requirements for YdcA or potentially alternative non-proteolytic functions.

What is currently known about the phenotypic impact of ydcA in B. subtilis?

Current research indicates that deletion of ydcA does not modify the phenotypic behavior of B. subtilis regardless of the presence or absence of yqgP . This is in stark contrast to yqgP, whose deletion causes notable growth defects under specific conditions. When comparing wild-type B. subtilis to strains with ydcA deletion, no significant differences in growth patterns have been observed in standard laboratory conditions. This lack of obvious phenotypic impact creates a significant research challenge in determining ydcA's biological role, suggesting either functional redundancy or activity under specific environmental conditions not typically replicated in laboratory settings.

How do the structural and functional properties of YdcA compare to YqgP?

While both YdcA and YqgP share sequence characteristics of rhomboid proteases, they exhibit distinct functional properties:

FeatureYdcAYqgP
Proteolytic activityNot detected in standard assaysActive against multiple substrates
Known substratesNone identifiedMgtE (magnesium transporter)
RegulationUnknownActivity modulated by magnesium, manganese, and zinc levels
Substrate preferenceUnknownCan cleave with Phe at P1 position (unusual for bacterial rhomboids)
Phenotypic impactNo observable impact when deletedDeletion causes growth defects

YqgP's cleavage of the magnesium transporter MgtE is potentiated under conditions of low magnesium and high manganese or zinc, suggesting a protective role in metal homeostasis . The absence of similar identified functions for YdcA raises important questions about its evolutionary retention in the B. subtilis genome.

What experimental approaches might reveal potential proteolytic activity of YdcA?

Given the challenges in detecting YdcA activity, several specialized experimental approaches should be considered:

  • Modified membrane environments: Since activity of rhomboid proteases can be enhanced by lipid composition (as demonstrated with PARL and cardiolipin ), systematic testing of YdcA in different membrane environments is warranted. Reconstitution of purified YdcA in proteoliposomes with varied lipid compositions may provide a more native-like environment that supports activity.

  • Substrate library screening: Using the multiplex substrate profiling approach applied to other rhomboid proteases , a comprehensive peptide library could identify potential cleavage preferences of YdcA. This approach revealed that PARL prefers substrates with bulky side chain Phe in P1 position, which differs from most bacterial rhomboid proteases except YqgP .

  • Environmental stress conditions: Testing YdcA activity under conditions mimicking environmental stresses (pH extremes, temperature shifts, osmotic stress) might reveal condition-specific activation. This is particularly relevant since YqgP activity is modulated by metal ion concentrations .

  • Co-expression with potential regulatory partners: YdcA might require interaction with specific proteins for activation, similar to how YqgP interacts with the ATP-dependent metalloprotease FtsH .

What are the optimal expression and purification strategies for studying recombinant YdcA?

Based on successful approaches with other rhomboid proteases:

  • Expression systems: Expression of YdcA could be optimized using approaches similar to those employed for human PARL, which was successfully expressed in Pichia pastoris with C-terminal tags to monitor expression . For YdcA, both the full-length form and potentially truncated versions should be tested to determine optimal expression and solubility.

  • Extraction and purification: Mild detergents like dodecylmaltoside (DDM) have proven effective for extracting rhomboid proteases with minimal delipidation . This approach preserves activity better than more aggressive detergents that might strip away essential lipids.

  • Affinity chromatography: Purification using affinity tags (His-tag, GFP-fusion) followed by tag removal has yielded milligram quantities of active rhomboid proteases . For YdcA, a similar strategy could be employed, with careful testing to ensure the tags don't interfere with potential activity.

  • Reconstitution in proteoliposomes: As demonstrated with PARL, significantly higher turnover rates can be observed when rhomboid proteases are reconstituted in proteoliposomes compared to detergent solutions . This approach might be crucial for detecting potentially weak YdcA activity.

How might potential substrates of YdcA be identified?

Identifying physiological substrates represents a major challenge in understanding YdcA function. Several approaches could be employed:

  • Comparative proteomics: Analyzing the membrane proteome of wild-type versus ΔydcA strains under various conditions might reveal differences in protein processing indicative of YdcA substrates.

  • Candidate approach: Given that YqgP cleaves the magnesium transporter MgtE , other transporters or membrane proteins involved in metal homeostasis represent logical candidates for YdcA activity.

  • Synthetic substrate testing: Creating fusion proteins containing potential cleavage sites, similar to the MBP-PGAM5-Thioredoxin construct used for PARL studies , could provide a platform for detecting YdcA activity.

  • In silico prediction: Computational analysis of B. subtilis membrane proteins for sequences resembling known rhomboid protease cleavage sites, particularly those with features distinct from YqgP substrates, might identify candidate substrates.

What approaches can determine if YdcA functions in protein quality control pathways?

Given that rhomboid proteases can function in protein quality control pathways, several experimental designs could explore this possibility for YdcA:

  • Stress response studies: Comparing wild-type and ΔydcA strains under conditions that challenge protein folding (heat shock, chemical stresses) might reveal functional roles not apparent under standard conditions.

  • Double knockout studies: Creating strains with deletions in both ydcA and genes involved in known protein quality control pathways could reveal synthetic phenotypes indicative of functional redundancy.

  • Protein aggregation assays: Monitoring the accumulation of aggregated or misfolded proteins in wild-type versus ΔydcA strains might indicate a role in preventing protein aggregation.

  • Interaction studies: Testing for physical interaction between YdcA and components of protein quality control machinery (such as FtsH, which interacts with YqgP ) could provide functional insights.

How can signal peptide optimization enhance recombinant YdcA expression and secretion?

The selection of appropriate signal peptides is critical for efficient expression and secretion of recombinant proteins in Bacillus systems:

  • Signal peptide library screening: As demonstrated with subtilisin BPN' from B. amyloliquefaciens, screening a library of signal peptides can identify sequences that significantly improve protein secretion . For YdcA, constructing fusions with multiple signal peptides from both B. subtilis (173 signal peptides tested in previous studies) and B. licheniformis (220 signal peptides) could identify optimal secretion leaders .

  • Cross-species compatibility: Importantly, signal peptides that improve secretion in B. subtilis often show similar improvements in other Bacillus species like B. licheniformis, with deviations typically less than 20% . This suggests that optimization in one system will likely translate to others.

  • High-throughput screening: Using protease activity assays on agar plates containing appropriate substrates enables rapid screening of thousands of clones for enhanced secretion . While YdcA itself lacks detected proteolytic activity, fusing it to a reporter domain could enable similar screening approaches.

  • Expression level normalization: When comparing different signal peptides, normalizing to expression level is essential to determine "specific activity" rather than just total yield . This approach has been effective in identifying signal peptides that improve the secretion efficiency of subtilisin BPN' by up to 7-fold .

Signal Peptide SourcePotential AdvantageSuccess in Previous Studies
B. subtilis nativeCompatibility with host machineryDemonstrated 3.5-fold increase for subtilisin BPN'
B. licheniformisCross-species optimizationSignal peptide dBli00338 increased protease secretion 7-fold
Hybrid designsCombining optimal featuresLimited exploration to date

What inhibitor studies could provide insights into YdcA's catalytic mechanism?

While no proteolytic activity has been detected for YdcA, inhibitor studies could still provide valuable structural and functional insights:

  • Standard serine protease inhibitor panel: Testing YdcA against typical serine protease inhibitors (PMSF, TPCK, DCI) might reveal atypical inhibition patterns. For reference, most rhomboid proteases are not inhibited by PMSF but show sensitivity to DCI and partial inhibition by TPCK .

  • Rhomboid-specific inhibitors: Peptidyl ketoamide inhibitors have shown specificity for rhomboid proteases at nanomolar concentrations . Testing these against YdcA might reveal binding even in the absence of detectable catalytic activity.

  • Active site probes: Using activity-based probes that covalently modify the catalytic serine might determine whether YdcA possesses a properly formed catalytic site regardless of whether activity can be detected with current substrates.

  • Structural studies with inhibitors: Co-crystallization or structural analysis of YdcA with bound inhibitors could reveal important differences in the catalytic machinery compared to active rhomboid proteases like YqgP.

How might YdcA function in the context of bacterial stress responses?

Despite no obvious phenotype in standard conditions, YdcA might play important roles during specific stresses:

  • Metal stress response: Given YqgP's role in magnesium homeostasis , YdcA might be involved in responses to other metal stresses. Systematic testing of growth and survival under various metal stress conditions (excess or limitation of different metals) could reveal condition-specific phenotypes.

  • Membrane stress adaptation: Rhomboid proteases often function in membrane protein quality control. Testing membrane integrity and composition in wild-type versus ΔydcA strains under membrane-perturbing conditions might reveal subtle differences.

  • Competitive fitness assays: While growth curves might not show differences, competitive co-culture experiments between wild-type and ΔydcA strains over multiple generations could reveal subtle fitness advantages under specific conditions.

  • Signaling pathway integration: YdcA might function in signal transduction pathways that are only activated under specific environmental conditions. Phosphoproteomic or transcriptomic analysis comparing wild-type and ΔydcA strains might identify affected pathways.

What experimental designs can differentiate between catalytic and non-catalytic functions of YdcA?

Given the lack of detected proteolytic activity, systematic approaches to distinguish between potential catalytic and non-catalytic functions are needed:

  • Catalytic site mutants: Creating mutations in the predicted catalytic residues of YdcA and comparing the resulting phenotypes to wild-type and full deletion strains could distinguish between structural and catalytic functions.

  • Domain swapping: Exchanging domains between YdcA and the active YqgP might create chimeric proteins that reveal which regions are responsible for the functional differences.

  • Protein interaction network analysis: Comparing the interaction partners of wild-type YdcA versus catalytic mutants could identify interactions that depend on an intact catalytic site versus those that are structure-dependent.

  • Evolutionary analysis: Examining the conservation patterns of catalytic versus non-catalytic residues across YdcA homologs in different species might reveal evolutionary pressures suggesting function.

How might synthetic biology approaches advance YdcA research?

Synthetic biology offers novel approaches to understand YdcA function:

  • Controlled expression systems: Developing tightly regulated inducible systems for YdcA expression would allow precise temporal control for studying acute effects of YdcA activity.

  • Reporter fusions: Creating fusions between YdcA and fluorescent proteins or split reporter systems could enable real-time monitoring of localization, interactions, and potential conformational changes in living cells.

  • Minimal system reconstitution: Building synthetic minimal systems containing YdcA and potential interaction partners could isolate and characterize specific functions without the complexity of the whole cell.

  • Directed evolution: Applying directed evolution to YdcA might generate variants with enhanced or altered activity that provide insights into the structural constraints on its function.

What comparative genomic approaches could reveal YdcA's evolutionary significance?

Understanding the evolutionary context of YdcA might provide functional insights:

  • Phylogenetic profiling: Analyzing the co-occurrence patterns of YdcA with other genes across bacterial species could identify functional associations.

  • Selection pressure analysis: Examining the types of selection pressure (purifying, neutral, positive) acting on different regions of YdcA across bacterial lineages might highlight functionally important domains.

  • Horizontal gene transfer assessment: Determining whether ydcA shows evidence of horizontal gene transfer could suggest acquisition of specialized functions.

  • Comparative expression analysis: Comparing the regulation of ydcA expression across different Bacillus species might reveal conserved regulatory mechanisms indicative of function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.