Recombinant Bacillus subtilis Putative ribonuclease-like protein yfkH (yfkH)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Operon Analysis

The yfkH gene is part of a putative three-gene operon (yfkJ-yfkI-yfkH) in B. subtilis . This operon is conserved across Bacillus species and Staphylococcus aureus, suggesting a functional linkage. Key findings include:

  • Co-occurrence: yfkH frequently clusters with yfkJ (a low-molecular-weight protein tyrosine phosphatase) and yfkK (a small conserved protein of unknown function) .

  • Stress Response Link: The operon’s promoter region contains a σ<sup>B</sup>-dependent stress response element, implicating YfkH in ethanol and heat stress resistance .

  • RNase BN Homology: yfkH shares homology with E. coli RNase BN, an inducible ribonuclease involved in tRNA processing .

Recombinant Production and Applications

Recombinant YfkH is primarily used for functional studies. Technical details from commercial production include:

ParameterDetail
Tag TypeHis-tag (determined during production)
Endotoxin Levels<1.0 EU/µg (LAL method)
StabilitySensitive to repeated freeze-thaw cycles; stable at 4°C for ≤1 week
ApplicationsAntibody production, enzymatic assays, structural studies

Biological Significance and Research Insights

While direct experimental validation of YfkH’s ribonuclease activity is lacking, contextual evidence highlights its potential roles:

  • Stress Resistance: Deletion of yfkJ (operon partner) reduces ethanol stress survival by 50%, while ywlE (another phosphatase) deletion causes a 75% reduction . YfkH may assist in stress adaptation through RNA turnover.

  • Functional Redundancy: B. subtilis strains lacking both YfkJ and YwlE exhibit no additive stress sensitivity, suggesting overlapping roles .

  • Degradosome Interaction: Though unconfirmed, YfkH could interact with RNA degradosome components like RNase Y, which coordinates mRNA processing .

Future Research Directions

Critical knowledge gaps include:

  1. Enzymatic Activity: Direct assays to confirm ribonuclease function and substrate specificity.

  2. Operon Dynamics: Mechanistic studies on how yfkJ-yfkI-yfkH cooperates during stress.

  3. Structural Analysis: Cryo-EM or X-ray crystallography to resolve YfkH’s active-site architecture.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing your requested tag type.
Synonyms
yfkH; BSU07900; Putative ribonuclease-like protein YfkH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yfkH
Target Protein Sequence
MSFLKELFSRYTLHEGQSKSAELAYFFLLSLFPFLIFMLTLTAYLPLSTDDVLGVIEQYA PASAMSLVESITHQTLNNRNGGLLSFGIIAALWSASNGMNAIVRSLNHAYDVEENRSFII VRLTSIFLTIAMVFTILVALLLPVFGREIGRLASDFVGASDLFLSVWAAIRWGVSPLVLL IVFSALYVIAPNKKLSLRFVMPGAVFATIGWIIVSTLFSFYVSTFANYSATYGSIGGIIV LMIWFYLSGILIILGGEINALLHKRKKLPDENPYH
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Bacillus subtilis yfkH protein?

The yfkH protein is a putative ribonuclease-like protein found in Bacillus subtilis strain 168, comprising 275 amino acids. Its sequence (MSFLKELFSR YTLHEGQSKS AELAYFFLLS LFPFLIFMLT LTAYLPLSTD DVLGVIEQYA PASAMSLVES ITHQTLNNRN GGLLSFGIIA ALWSASNGMN AIVRSLNHAY DVEENRSFII VRLTSIFLTI AMVFTILVAL LLPVFGREIG RLASDFVGAS DLFLSVWAAI RWGVSPLVLL IVFSALYVIA PNKKLSLRFV MPGAVFATIG WIIVSTIFSF YVSTFANYSA TYGSIGGIIV LMIWFYLSGI LIILGGEINA LLHKRKKLPD ENPYH) indicates a potentially membrane-associated protein with putative ribonuclease activity . While its exact function remains to be fully characterized, its classification suggests involvement in RNA processing or degradation pathways, similar to other ribonucleases in B. subtilis such as RNase Y, which plays a crucial role in initiating mRNA decay .

How does yfkH relate to other ribonucleases in Bacillus subtilis?

B. subtilis contains several ribonucleases involved in RNA metabolism, with RNase Y being a key enzyme initiating mRNA decay. While yfkH is classified as a putative ribonuclease-like protein, its exact relationship with other ribonucleases like RNase Y remains to be fully elucidated. RNase Y is known to participate in a multiprotein complex similar to the RNase E-based degradosome in E. coli, interacting with polynucleotide phosphorylase (PNPase), helicase CshA, and glycolytic enzymes . Researchers investigating yfkH should consider potential functional similarities or differences with well-characterized ribonucleases, particularly examining whether yfkH participates in similar protein complexes or degradosome-like structures that facilitate RNA processing.

What genomic context surrounds the yfkH gene in Bacillus subtilis?

The yfkH gene (designated BSU07900 according to ordered locus names) is part of the B. subtilis genome, which contains approximately 4,100 coding sequences . Understanding its genomic context requires examining nearby genes and potential operons. The B. subtilis genome is known to contain regions with varying A+T content, bacteriophage elements, and duplicated sequences . When investigating yfkH's function, researchers should examine whether it resides in a region associated with horizontally transferred elements, as many genes in A+T-rich islands (84% of genes with unidentified function) correspond to functions found in bacteriophages or transposons . Genomic context analysis may provide insights into yfkH's evolutionary history and functional relationships.

What expression systems are optimal for recombinant yfkH protein production?

For recombinant yfkH production, researchers can employ both homologous (B. subtilis) and heterologous (E. coli) expression systems, each with distinct advantages:

Homologous expression in B. subtilis:
A system similar to that used for recombinant human growth hormone (rhGH) expression in B. subtilis can be adapted for yfkH. This approach involves creating a hybrid gene comprising a signal DNA sequence (such as from B. licheniformis serine alkaline protease gene, subC) and the yfkH coding sequence, cloned into a suitable vector (e.g., pMK4) under an appropriate promoter (e.g., deg-promoter) . This system mimics natural protein synthesis and secretion pathways in B. subtilis, potentially producing properly folded protein.

Heterologous expression in E. coli:
For higher yields, E. coli-based expression using specialized strains like NiCo21(DE3) can reduce common contamination issues during purification . Expression optimization should include:

ParameterOptimization Considerations
Temperature18-30°C range; lower temperatures for improved folding
Induction timingMid-log phase (OD600 0.6-0.8) for optimal balance
Inducer concentration0.1-1.0 mM IPTG; titration recommended
Media compositionDefined media with glucose (similar to that yielding 70 mg/L for rhGH in B. subtilis)
Harvest time24-36 hours post-induction (based on similar B. subtilis expression systems)

The choice between systems should be guided by experimental requirements regarding protein modifications, yield, and downstream applications.

How can secretion of recombinant yfkH be optimized in Bacillus subtilis?

Optimizing secretion of recombinant yfkH in B. subtilis requires strategic selection of signal peptides and culture conditions. Based on successful secretion of other recombinant proteins in B. subtilis, the following methodological approach is recommended:

  • Signal peptide selection: The serine alkaline protease signal sequence from B. licheniformis (pre(subC)) has proven effective for secretion of heterologous proteins like human growth hormone in B. subtilis . This signal peptide facilitates proper processing by B. subtilis signal-peptidase, resulting in the mature protein being secreted into the culture medium.

  • Expression vector design: Construct a fusion between the selected signal peptide and the yfkH coding sequence in a stable B. subtilis expression vector like pMK4, placing the construct under control of a strong, preferably inducible promoter such as the deg-promoter .

  • Culture optimization: A glucose-based defined medium has been shown to support high-level recombinant protein production in B. subtilis, with optimal harvesting times around 32 hours post-induction . Monitor growth curves and protein secretion kinetics to determine optimal harvest time specific to yfkH.

  • Proteolytic degradation prevention: Incorporate protease inhibitors or consider using protease-deficient B. subtilis strains to minimize degradation of secreted recombinant yfkH protein.

Monitoring proper signal peptide processing through N-terminal sequencing and mass spectrometry analysis is crucial to confirm production of mature, correctly processed yfkH protein .

What are the critical parameters for scaling up yfkH production?

Scaling up yfkH production from laboratory to larger volumes requires careful optimization of multiple parameters:

ParameterSmall-scale (≤1L)Medium-scale (1-10L)Large-scale (>10L)
Oxygen transferShaker flasks (250 rpm)Baffled vessels with enhanced aerationControlled dissolved oxygen (>30% saturation)
pH controlBuffered mediaAutomated pH control (pH 7.0±0.2)Continuous pH monitoring and adjustment
Nutrient feedingBatch modeFed-batch with glucose monitoringContinuous feeding strategy based on growth rate
Temperature regulationIncubator controlJacketed vesselsPrecise temperature control systems
Induction strategySingle point inductionGradient or multi-point inductionOptimized induction timing based on biomass
Harvest timingFixed time post-inductionMonitored via protein expression kineticsIntegrated online monitoring systems

For B. subtilis expression systems, monitoring excreted organic acids and amino acids is critical, as B. subtilis strains carrying recombinant protein expression constructs typically exhibit higher organic acid excretion compared to control strains . Carbon source utilization efficiency is also important, with documented yields of approximately 9 g of recombinant protein per kg of substrate for similar recombinant proteins in B. subtilis .

What purification strategy is most effective for recombinant yfkH?

The most effective purification strategy for recombinant yfkH combines affinity chromatography with complementary techniques to achieve high purity and yield:

Primary purification approach:

  • Affinity purification: If expressing His-tagged yfkH, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is recommended as the initial capture step. Be aware that B. subtilis endogenous proteins like GlmS, SlyD, ArnA, and Can can co-purify with His-tagged proteins . To address this, consider:

    • Using specialized expression hosts like NiCo21(DE3) where these contaminating proteins are modified to prevent co-purification

    • Alternative tag systems (e.g., SUMO, GST) if contamination persists

    • Stringent washing with 20-40 mM imidazole before elution

  • Secondary purification steps: Following affinity purification, implement:

    • Size exclusion chromatography for both further purification and characterization of oligomeric state, particularly important if yfkH forms dimers like other ribonucleases

    • Ion exchange chromatography as a polishing step, with column selection based on yfkH's theoretical isoelectric point

  • Tag removal considerations: If tag removal is required for functional studies, incorporate a specific protease cleavage site between the tag and yfkH. TEV protease cleavage followed by a second IMAC step to remove cleaved tag and protease is a common approach.

For non-tagged protein purification from B. subtilis secretion systems, ammonium sulfate precipitation followed by conventional chromatography techniques may be employed, though yields are typically lower.

How can the functional activity of purified yfkH be assessed?

As a putative ribonuclease-like protein, yfkH's functional activity should be assessed through multiple complementary approaches:

  • Ribonuclease activity assays:

    • Substrate specificity testing using various RNA substrates (total RNA, specific mRNAs, synthetic oligoribonucleotides)

    • Monitoring RNA degradation via gel electrophoresis (PAGE with SYBR Gold staining)

    • Fluorescence-based assays using labeled RNA substrates to measure kinetic parameters

  • Binding assays:

    • Electrophoretic mobility shift assays (EMSA) to detect RNA-protein interactions

    • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) for quantitative binding parameters

    • Filter-binding assays for rapid screening of RNA substrate preferences

  • Structural and biophysical characterization:

    • Circular dichroism (CD) to assess secondary structure content

    • Differential scanning fluorimetry (DSF) for thermal stability analysis

    • Limited proteolysis to identify stable domains

  • Comparative analysis:

    • Side-by-side comparison with known ribonucleases like RNase Y

    • Activity testing under various conditions (pH range 5.5-8.5, divalent cation concentrations 0-10 mM, ionic strength 50-300 mM NaCl)

Each assay should include appropriate positive controls (known ribonucleases) and negative controls (buffer only, heat-inactivated yfkH) to validate results.

What analytical methods are recommended for assessing yfkH purity and integrity?

Multiple analytical methods should be employed in combination to comprehensively assess yfkH purity and integrity:

Analytical MethodInformation ProvidedTypical Acceptance Criteria
SDS-PAGEPurity assessment, apparent molecular weight>95% purity by densitometry
Western blotIdentity confirmation using anti-yfkH or anti-tag antibodiesSingle specific band at expected MW
Mass spectrometryPrecise molecular weight, post-translational modificationsMass accuracy within 0.1% of theoretical
N-terminal sequencingConfirmation of signal peptide processingMatches predicted mature protein sequence
Size exclusion chromatographyOligomeric state, aggregation assessment>90% monodisperse peak
Dynamic light scatteringHydrodynamic radius, polydispersityPolydispersity index <0.2
UV-Vis spectroscopyProtein concentration, nucleic acid contaminationA260/A280 ratio <0.7 for pure protein
Circular dichroismSecondary structure integrityConsistent spectrum batch-to-batch
Endotoxin testingContamination assessment (crucial for functional studies)<0.1 EU/mg protein

For storage stability assessment, analyze samples after storage at recommended conditions (-20°C to -80°C in 50% glycerol Tris buffer) at regular intervals (0, 1, 3, and 6 months) using activity assays and the analytical methods above to confirm retention of structural and functional integrity.

How can structural studies of yfkH be designed and optimized?

Designing and optimizing structural studies of yfkH requires integrating multiple techniques and careful sample preparation:

  • X-ray crystallography approach:

    • Screen multiple constructs (full-length, truncations based on predicted domains)

    • Optimize protein concentration (10-15 mg/mL initial trials)

    • Employ sparse matrix screening followed by optimization of promising conditions

    • Consider surface entropy reduction mutations to promote crystallization

    • If dimerization occurs (as with other ribonucleases ), explore both dimeric and monomeric forms

  • NMR spectroscopy considerations:

    • Prepare uniformly labeled (15N, 13C) protein samples in NMR-compatible buffers

    • Begin with 15N-HSQC experiments to assess spectral quality

    • For larger proteins or complexes (>25 kDa), consider TROSY-based experiments

    • Design similar to successful approaches used for RNase Y N-terminal domain

  • Cryo-EM for larger complexes:

    • Particularly valuable if yfkH participates in larger multiprotein complexes

    • Optimize sample concentration, grid preparation, and vitrification conditions

    • Consider GraFix method for stabilizing transient complexes

  • Computational structural biology:

    • Employ AlphaFold or similar prediction tools as starting models

    • Conduct molecular dynamics simulations to explore conformational flexibility

    • Integrate experimental data with computational models for hybrid approaches

  • Sample preparation optimization:

    • Test multiple buffer compositions for optimal stability

    • Ensure monodispersity through SEC-MALS analysis

    • Evaluate metal ion requirements through differential scanning fluorimetry

Structural information should be validated through complementary approaches and correlated with functional studies to establish structure-function relationships.

What experimental design considerations are crucial for investigating yfkH's role in RNA metabolism?

Investigating yfkH's potential role in RNA metabolism requires a comprehensive experimental design addressing multiple aspects:

  • Gene knockout and complementation studies:

    • Generate yfkH deletion strain in B. subtilis

    • Complement with wild-type and mutant variants

    • Assess phenotypic changes including growth rate, stress responses, and RNA decay kinetics

  • Transcriptome analysis:

    • Compare RNA profiles between wild-type and ΔyfkH strains

    • Employ RNA-seq with appropriate statistical design:

      • Minimum 3 biological replicates per condition

      • Include time-course analysis for dynamic processes

      • Consider differential RNA-seq to identify processing sites

  • RNA substrate identification:

    • Implement CLIP-seq (crosslinking immunoprecipitation) to identify direct RNA targets

    • Validate key targets through in vitro binding and processing assays

    • Map precise cleavage sites using primer extension or 5' RACE

  • Protein interaction network:

    • Identify protein partners through co-immunoprecipitation or bacterial two-hybrid screening

    • Validate interactions through reciprocal pull-downs and co-localization studies

    • Investigate potential participation in degradosome-like complexes similar to RNase Y

  • Kinetic analysis of RNA processing:

    • Develop real-time assays using fluorescent RNA substrates

    • Determine enzymatic parameters (Km, kcat, substrate specificity)

    • Compare activity under various physiological conditions

In all experimental designs, appropriate controls should include known ribonucleases (positive controls), catalytically inactive variants (negative controls), and rigorous statistical analysis of results.

How can protein-protein interactions of yfkH be effectively investigated?

Investigating protein-protein interactions of yfkH requires a multi-faceted approach combining in vivo and in vitro techniques:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged yfkH in B. subtilis to capture native interaction partners

    • Implement SILAC or TMT labeling for quantitative comparison

    • Use appropriate controls (tag-only, unrelated protein) to filter non-specific interactions

    • Consider crosslinking to capture transient interactions

  • Bacterial two-hybrid (B2H) and yeast two-hybrid (Y2H) screening:

    • Screen against genomic libraries or candidate interactors

    • Validate positive interactions through multiple reporter systems

    • Map interaction domains through truncation analysis

  • Fluorescence-based interaction assays:

    • Förster resonance energy transfer (FRET) for direct interaction assessment

    • Fluorescence complementation assays (BiFC) for in vivo visualization

    • Microscale thermophoresis (MST) for quantitative binding parameters

  • Surface plasmon resonance (SPR):

    • Determine binding kinetics and affinity constants

    • Investigate influence of RNA substrates on protein-protein interactions

    • Assess effects of buffer conditions on interaction stability

  • Comparative analysis with known ribonuclease complexes:

    • Investigate potential parallels with the RNase Y degradosome complex

    • Explore interactions with polynucleotide phosphorylase (PNPase), helicase CshA, and metabolic enzymes

    • Test competitor peptides derived from known interaction domains

Special attention should be given to potential dimerization of yfkH itself, similar to the dimeric structure observed with RNase Y's N-terminal domain which forms a coiled-coil structure important for dimerization .

What are common challenges in recombinant yfkH expression and how can they be overcome?

ChallengePossible CausesSolution Strategies
Low expression levelsCodon bias, toxic effects, promoter inefficiencyOptimize codon usage for host, use inducible tight promoters, lower induction temperature (18-25°C)
Inclusion body formationRapid expression rate, improper foldingReduce induction temperature, co-express chaperones, use solubility tags (SUMO, MBP), optimize lysis buffer
Proteolytic degradationHost proteases, unstable domainsAdd protease inhibitors, use protease-deficient strains, optimize harvest timing, identify/remove unstable regions
Contaminating host proteinsCo-purification of metal-binding proteinsUse specialized strains like NiCo21(DE3) , increase wash stringency, employ dual tagging strategies
Poor secretion in B. subtilisSignal peptide inefficiency, cell wall interactionTest alternative signal peptides, optimize culture conditions, monitor excreted organic acids
Loss of activityImproper folding, cofactor requirementsScreen buffer conditions, test metal ion addition (Mg2+, Mn2+), optimize purification to maintain native state

For membrane-associated proteins like yfkH (based on its sequence characteristics) , additional considerations include:

  • Testing detergent panels for optimal extraction

  • Employing amphipols or nanodiscs for stabilization

  • Considering lipid composition effects on activity

How can researchers distinguish between the functions of yfkH and other ribonucleases in B. subtilis?

Distinguishing the specific functions of yfkH from other ribonucleases in B. subtilis requires a systematic approach combining genetic, biochemical, and high-throughput techniques:

  • Sequential and combinatorial gene deletions:

    • Create single, double, and triple deletion strains involving yfkH and other ribonucleases

    • Analyze synthetic phenotypes and genetic interactions

    • Employ complementation with chimeric proteins to map functional domains

  • Substrate specificity profiling:

    • Develop high-throughput RNA substrate libraries

    • Compare cleavage patterns and kinetics across different ribonucleases

    • Map sequence and structural preferences using SELEX-seq approaches

  • Transcriptome-wide analyses:

    • Implement comparative RNA-seq across ribonuclease mutants

    • Analyze differential effects on RNA classes (mRNA, rRNA, sRNA)

    • Use pulse-chase labeling to distinguish primary from secondary effects

  • Structural comparison approaches:

    • Compare structural features with RNase Y, particularly examining potential parallel coiled-coil structures in the N-terminal domain

    • Identify unique structural elements that could confer specific functions

    • Create domain-swapped variants to map functional specificities

  • Temporal and spatial regulation:

    • Investigate differential expression patterns under various growth conditions

    • Examine subcellular localization using fluorescent protein fusions

    • Analyze potential co-localization with other degradosome components

By systematically comparing yfkH with well-characterized ribonucleases like RNase Y through these approaches, researchers can establish its unique functional niche in B. subtilis RNA metabolism.

What advanced analytical techniques can resolve contradictory data in yfkH research?

When faced with contradictory data in yfkH research, researchers should employ advanced analytical techniques to resolve discrepancies:

  • Single-molecule approaches:

    • Single-molecule FRET to directly observe binding and catalytic events

    • Atomic force microscopy to visualize protein-RNA complexes

    • Zero-mode waveguides to monitor reaction kinetics in real-time

  • Advanced mass spectrometry techniques:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes

    • Native mass spectrometry to analyze intact complexes and stoichiometry

    • Crosslinking mass spectrometry (XL-MS) to identify interaction interfaces

  • Next-generation sequencing applications:

    • CLIP-seq variants (iCLIP, PAR-CLIP) to map binding sites with nucleotide resolution

    • Nanopore direct RNA sequencing to identify RNA modifications affected by yfkH

    • Ribosome profiling to assess impacts on translation

  • Statistical and computational approaches:

    • Bayesian statistical frameworks to integrate diverse datasets

    • Machine learning methods to identify subtle patterns in high-dimensional data

    • Molecular dynamics simulations to test mechanistic hypotheses

  • Controlled experimental design variations:

    • Systematic buffer optimization using Design of Experiments (DoE) approaches

    • Standardization of protein preparations across laboratories

    • Blind testing protocols to eliminate unconscious bias

For optimal experimental planning when investigating contradictory results, researchers should employ designs with proper randomization, blocking, and sufficient replication to ensure statistical power. Applying statistical design principles similar to those used in event-related fMRI experiments , which carefully optimize efficiency and power through appropriate jittering and randomization of intervals, can significantly enhance the robustness of biochemical and molecular biology experiments with yfkH.

What are the most significant open questions in yfkH research?

The study of Bacillus subtilis putative ribonuclease-like protein yfkH remains an evolving field with several crucial unanswered questions. The primary open questions include: (1) the precise enzymatic activity and substrate specificity of yfkH, particularly whether it functions as a bona fide ribonuclease or possesses alternative biochemical activities; (2) its physiological role in B. subtilis, including potential participation in RNA degradation pathways or other cellular processes; (3) the structural basis for its function, especially considering potential parallels with the dimeric coiled-coil structure observed in RNase Y ; (4) its integration into the wider RNA metabolism network, including potential interactions with the degradosome-like complex containing RNase Y; and (5) the evolutionary conservation and diversification of yfkH function across different bacterial species.

Research addressing these questions will significantly enhance our understanding of bacterial RNA metabolism and potentially reveal novel regulatory mechanisms. Future investigations should integrate structural biology, functional genomics, and systems biology approaches to comprehensively characterize this protein's role in B. subtilis physiology.

How can new methodologies advance yfkH research?

Emerging methodologies offer promising avenues to accelerate research on yfkH and resolve persistent questions. Cryo-electron microscopy advancements can elucidate the structure of yfkH alone and in complexes, particularly if it forms higher-order assemblies like other RNA-processing enzymes. AlphaFold and related AI-based structure prediction tools, which have proven valuable for analyzing proteins like RNase Y , can provide initial structural models to guide experimental design. CRISPR-based technologies enable precise genome editing in B. subtilis to create conditional mutants, allowing temporal control over yfkH expression for studying essential functions. Long-read direct RNA sequencing can comprehensively map RNA processing sites across the transcriptome, potentially identifying yfkH-specific signatures. Proximity labeling methods (BioID, APEX) can map the yfkH protein interaction network in vivo, revealing previously undetected transient interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.