Recombinant Bacillus subtilis Putative sensory transducer protein yvaQ (yvaQ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yvaQ; BSU33690; Putative sensory transducer protein YvaQ; Methyl-accepting chemotaxis protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-566
Protein Length
Full Length of Mature Protein
Species
Bacillus subtilis (strain 168)
Target Names
yvaQ
Target Protein Sequence
QHIIQKTDEINTKWIDGIKGITSINYVTEHLSSKEKDFLIYTDKSKMDTLDQEMNQIMED INQKLDNYEKTISTDKEQKLFEQLQTKVNTYMDIHAQIIESGRTNDMDKARGLLVQTEAS FEDMKKTITQLVDLNQEGSNTAVKETKAVYHKGLIYTALLVAASILISIFIWLYITRNIV KPIIRMKESANHIAEGDLSNDMEALNSKDELGDLNEALQKMVGNLRDIVGYSKDISSRVL SSSQVLATATNETRSGSKHITETMNEMAEGSEQQAQDAVTIAESMNEFTESIDKAYNHGI TISDTSQNVLELAVSGNENMATSLQQMKTIHHIVEEAVHKVRSLEQHSQDINKLVQVING IAEQTNLLSLNAAIEAARAGESGKGFAVVAEEVRKLADGVSDSVQDITRIVNGTQQEIHT VITYLESSFTEVEKGTENLTDTGQAMQHIKQSVTHVADSIKEVTDGLKQLTNQSITINQS IENIASVSEESAAGIEETFSITEQSAHSMDQVLLNAEELEQLANELNEKMGQFTI
Uniprot No.

Target Background

Function
Chemotactic-signal transducers detect changes in attractant and repellent concentrations. They transduce external signals into intracellular responses and facilitate sensory adaptation via methylation level variations. Attractants increase methylation levels, while repellents decrease them.
Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural composition of the Bacillus subtilis YvaQ protein?

YvaQ (UniProt ID: O32239) is a putative sensory transducer protein from Bacillus subtilis strain 168 consisting of 566 amino acids. The protein is classified under the YVAQ_BACSU designation in the UniProtKB database and has several identical sequences identified in related Bacillus subtilis strains including NCIB 3610, ATCC 6051, and DSM 10 . Structural modeling through SWISS-MODEL has revealed three available models with varying QMEAN scores (0.74, 0.62, and 0.58), suggesting moderate confidence in the predicted structures. The highest confidence model was built using template 2ch7.1.B as a monomer structure .

The protein likely contains sensory domains characteristic of transducer proteins involved in signal detection and transmission within the bacterial cell. While detailed structural information is limited, comparative analysis with other sensory transducers suggests YvaQ may contain transmembrane regions and cytoplasmic signaling domains typical of bacterial two-component systems.

How does YvaQ function in the context of Bacillus subtilis biology?

As a putative sensory transducer protein, YvaQ likely plays a role in environmental sensing and signal transduction pathways in B. subtilis. This bacterium is known for its remarkable adaptability to diverse environments, including soil, plant roots, and gastrointestinal tracts of animals . The M-CGH (microarray-based comparative genomic hybridization) analysis of B. subtilis strains has revealed variability in genes encoding environmental sensing and cell surface-associated proteins, suggesting these components are crucial for adaptation to specific ecological niches .

YvaQ may contribute to this environmental adaptability by detecting specific extracellular signals and initiating appropriate cellular responses. Like other sensory transducers, it likely participates in signal cascades that regulate gene expression based on environmental conditions, potentially influencing processes such as biofilm formation, sporulation, or metabolic adjustments.

What experimental approaches are recommended for initial characterization of recombinant YvaQ?

Initial characterization of recombinant YvaQ should employ a multi-faceted approach:

  • Expression and Purification: Express the protein with a His-tag in E. coli or yeast expression systems, following protocols similar to those used for other B. subtilis recombinant proteins . Purify using affinity chromatography to >80% purity as verified by SDS-PAGE.

  • Structural Analysis: Employ circular dichroism (CD) spectroscopy to assess secondary structure content and proper folding. Consider limited proteolysis coupled with mass spectrometry to identify domain boundaries.

  • Functional Assays: Design binding assays to identify potential ligands or stimuli recognized by YvaQ. For initial screening, utilize thermal shift assays to detect ligand-induced protein stabilization.

  • Localization Studies: Develop GFP-fusion constructs to determine cellular localization of YvaQ in B. subtilis, which can provide insights into its functional context.

  • Conservation Analysis: Compare the sequence with other known sensory transducers in B. subtilis and related species to identify conserved functional domains and predict potential roles.

ApproachMethodologyExpected Outcome
Protein ExpressionHis-tagged expression in E. coli/yeastPurified protein (>80% by SDS-PAGE)
Structural AnalysisCD spectroscopy, limited proteolysisSecondary structure composition, domain organization
Functional AssessmentThermal shift assays, ligand binding studiesPotential ligands or stimuli identification
LocalizationFluorescent protein fusion microscopyCellular distribution pattern
Comparative AnalysisSequence alignment, phylogenetic analysisIdentification of conserved domains and related proteins

How can I design experiments to elucidate the signal transduction pathway involving YvaQ?

Elucidating the signal transduction pathway involving YvaQ requires a systematic approach:

Step 1: Identify interaction partners
Employ bacterial two-hybrid systems or pull-down assays using His-tagged YvaQ to identify protein-protein interactions. Co-immunoprecipitation experiments followed by mass spectrometry can reveal physiologically relevant binding partners in B. subtilis. When expressing recombinant YvaQ, ensure appropriate buffer conditions (PBS buffer is commonly used) to maintain protein stability and native conformation during interaction studies.

Step 2: Establish genetic context
Generate yvaQ knockout strains of B. subtilis and perform transcriptomic analysis using RNA-seq to identify genes whose expression is affected by YvaQ deletion. This approach can reveal downstream components of the signaling pathway. Complementation studies with wild-type and mutated versions of YvaQ can confirm the specificity of observed effects.

Step 3: Determine phosphorylation dynamics
If YvaQ functions within a canonical two-component system, investigate phosphorylation patterns using phospho-specific antibodies or mass spectrometry approaches. Time-course experiments following exposure to different stimuli can reveal activation dynamics.

Step 4: Connect to physiological outcomes
Assess how YvaQ impacts B. subtilis adaptation to environmental changes by measuring biofilm formation, sporulation efficiency, and metabolic responses in wild-type versus yvaQ mutant strains under various conditions. Given B. subtilis' remarkable adaptability to diverse environments , YvaQ may influence ecologically relevant behaviors.

What methods are most effective for studying YvaQ's potential role in biofilm formation?

Investigating YvaQ's potential role in biofilm formation should leverage B. subtilis' established status as a model organism for studying multicellular communities :

  • Comparative biofilm assays: Compare biofilm formation between wild-type and ΔyvaQ strains using crystal violet staining in static cultures and flow cell systems for dynamic biofilm development.

  • Complementation analysis: Reintroduce wild-type yvaQ and various mutant versions into the knockout strain to identify critical domains for biofilm functionality.

  • Localization during biofilm development: Create fluorescently tagged YvaQ proteins to track localization during biofilm formation using confocal microscopy. This approach can reveal whether YvaQ localizes to specific regions within the developing biofilm.

  • Integration with known biofilm pathways: Investigate potential interactions between YvaQ and established biofilm components such as the yqxM and eps operons, which encode proteins and polysaccharides in the extracellular matrix . Create double mutants to establish genetic relationships.

  • Environmental signal response: Test biofilm formation under various environmental conditions (nutrient limitation, temperature, pH) to determine if YvaQ responds to specific signals that affect biofilm development.

The development of biofilms in B. subtilis NCIB3610 (a possible progenitor of the sequenced strain 168) has been extensively characterized, providing an excellent framework for studying YvaQ's potential contribution to this complex developmental process.

How can I effectively study the membrane topology and orientation of YvaQ?

As a putative sensory transducer protein, understanding YvaQ's membrane topology is crucial for elucidating its function. Several complementary approaches can be employed:

Computational prediction:
Begin with bioinformatic tools like TMHMM, TOPCONS, and Phobius to predict transmembrane regions and protein orientation. These predictions provide a foundation for experimental design.

Experimental topology mapping:

  • PhoA/LacZ fusion analysis: Create fusion proteins with alkaline phosphatase (PhoA, active in periplasm) and β-galactosidase (LacZ, active in cytoplasm) at various positions within YvaQ. Enzymatic activity indicates the cellular location of the fusion junction.

  • Cysteine scanning mutagenesis: Introduce cysteines at various positions and assess their accessibility to membrane-impermeable sulfhydryl reagents, revealing exposed regions.

  • Protease protection assays: Treat membrane preparations containing YvaQ with proteases and analyze the protected fragments by mass spectrometry to determine membrane-embedded regions.

Structural validation:
Consider using the available SWISS-MODEL structures of YvaQ to guide your experimental design, focusing on regions with high QMEAN scores. The three available models (templates 2ch7.1.B, 8c5v.1.L, and 3ja6.1.G) can provide insights into potential structural features.

What are the optimal conditions for expressing and purifying recombinant YvaQ?

Based on available information for similar B. subtilis recombinant proteins, the following protocol is recommended:

Expression system selection:
E. coli or yeast expression systems have been successfully used for recombinant B. subtilis proteins . For YvaQ, consider using E. coli BL21(DE3) with a pET-based vector for cytoplasmic expression or a specialized strain for membrane protein expression if transmembrane domains are present.

Expression optimization:

  • Temperature: Test expression at 16°C, 25°C, and 37°C

  • Induction: Vary IPTG concentration (0.1-1.0 mM)

  • Duration: Test 4-hour expression versus overnight induction

  • Media supplements: Consider adding glycerol (1-5%) to stabilize membrane proteins

Purification strategy:

  • His-tag affinity purification using Ni-NTA resin, with protein elution in PBS buffer

  • Size exclusion chromatography to remove aggregates and ensure monodispersity

  • Aim for >80% purity as assessed by SDS-PAGE

Storage conditions:
For short-term storage, maintain purified YvaQ at 4°C in PBS buffer. For long-term storage, store at -20°C to -80°C , potentially with glycerol added as a cryoprotectant.

ParameterRecommended ConditionAlternative Conditions to Test
Expression SystemE. coli BL21(DE3)C41(DE3) for membrane proteins
VectorpET with N-terminal His-tagC-terminal His-tag variant
Induction Temperature25°C16°C or 37°C
IPTG Concentration0.5 mM0.1 mM or 1.0 mM
Expression DurationOvernight4-6 hours
Lysis BufferPBS with protease inhibitorsTris-based buffers (pH 7.5-8.0)
Purification MethodNi-NTA followed by SECAdditional ion exchange step if needed

What strategies can address challenges in expressing full-length transmembrane proteins like YvaQ?

Expressing full-length transmembrane proteins presents unique challenges that can be addressed through several specialized approaches:

Domain-based expression strategy:
If full-length expression proves difficult, consider expressing individual domains separately. Based on bioinformatic analysis and the available SWISS-MODEL structures , identify soluble domains that can be expressed independently. This domain-based approach can provide valuable structural and functional information while circumventing the challenges of full-length membrane protein expression.

Membrane-mimetic systems:
When expression of transmembrane regions is necessary, incorporate these strategies:

  • Use mild detergents (DDM, LDAO) during purification to solubilize membrane regions

  • Consider nanodiscs or amphipols for maintaining native-like membrane environments

  • Test co-expression with chaperones like GroEL/GroES to improve folding efficiency

Fusion protein approaches:

  • MBP (maltose-binding protein) fusion to enhance solubility

  • SUMO tag to improve folding and enable tag removal without remaining amino acids

  • Mistic fusion for improved membrane protein insertion in E. coli

Alternative expression systems:
If E. coli expression is problematic, consider:

  • Cell-free expression systems supplemented with lipids or detergents

  • Bacillus subtilis expression for homologous production

  • Insect cell expression systems for complex eukaryotic membrane proteins

The expression and purification challenges should be systematically addressed, beginning with the approaches that have been successful for other B. subtilis proteins, such as the His-tag purification strategy described in source .

How can I identify the environmental signals detected by YvaQ?

Identifying environmental signals recognized by YvaQ requires a comprehensive screening approach:

Broad-spectrum ligand screening:

  • Thermal shift assays (differential scanning fluorimetry) to screen for compounds that stabilize YvaQ

  • Surface plasmon resonance (SPR) screening with candidate ligands

  • Isothermal titration calorimetry (ITC) for detailed binding thermodynamics

Physiological response mapping:
Create a reporter system where YvaQ activation leads to measurable outputs such as fluorescence or luciferase expression. Expose B. subtilis carrying this reporter system to various environmental conditions to identify specific triggers for YvaQ activity.

Comparative genomics approach:
Analyze YvaQ within the context of B. subtilis strain diversity. Since B. subtilis exhibits considerable genome diversity adapted to different ecological niches , comparing YvaQ sequence and function across strains may reveal environment-specific adaptations and corresponding signals.

Potential signal categories to test:

  • Nutrients and metabolites: Carbohydrates, amino acids, lipids

  • Environmental stressors: pH, temperature, osmolarity

  • Microbial signals: Quorum sensing molecules, competitive metabolites

  • Host-derived signals: Relevant for strains adapted to gastrointestinal environments

This multifaceted approach leverages B. subtilis' known adaptability to diverse environments, including soils, plant roots, and animal GI tracts , to systematically identify the specific signals detected by YvaQ.

What techniques are recommended for studying YvaQ's potential role in B. subtilis adaptation to different environments?

Given B. subtilis' remarkable ecological diversity , YvaQ may contribute to environmental adaptation through sensory functions. The following techniques are recommended:

Comparative growth and survival assays:

  • Develop growth curves for wild-type and ΔyvaQ strains under diverse conditions (nutrient limitation, temperature extremes, osmotic stress, pH variation)

  • Measure survival rates following exposure to environmental stressors

  • Assess competitive fitness in mixed cultures with other bacterial species

Transcriptomic and proteomic profiling:

  • Perform RNA-seq analysis comparing wild-type and ΔyvaQ strains under various conditions

  • Use quantitative proteomics to identify differences in protein expression patterns

  • Focus particularly on genes involved in stress response, metabolism, and cell surface modifications

In vivo colonization studies:
Given B. subtilis' ability to colonize the gastrointestinal tract of animals , investigate how YvaQ affects colonization:

  • Compare gut colonization efficiency between wild-type and ΔyvaQ strains

  • Assess biofilm formation within the GI tract environment

  • Measure persistence and competitive ability against resident microflora

Environmental sensing reconstitution:
Develop in vitro systems to reconstitute YvaQ signaling with potential downstream components, using purified recombinant proteins to verify direct signal transduction mechanisms.

These approaches leverage the extensive knowledge of B. subtilis ecology and adaptation to systematically investigate YvaQ's potential role in sensing and responding to different environments.

What are the best approaches for generating site-specific mutations in YvaQ for structure-function studies?

Site-directed mutagenesis of YvaQ can be accomplished through several complementary approaches:

PCR-based mutagenesis:

  • QuikChange mutagenesis: Design complementary primers containing the desired mutation and use high-fidelity polymerase for whole-plasmid amplification.

  • Overlap extension PCR: Generate two fragments with overlapping regions containing the mutation, then combine in a second PCR reaction.

  • Golden Gate assembly: Design a mutagenic insert with BsaI sites for seamless assembly into a destination vector.

CRISPR-Cas9 genome editing:
For direct chromosomal modification in B. subtilis:

  • Design sgRNA targeting the yvaQ gene region

  • Provide repair template containing desired mutations

  • Select transformants and verify mutations by sequencing

Key residues to target:
Based on structural models and conserved domains in sensory transducers, prioritize mutations in:

  • Predicted ligand-binding pockets

  • Potential phosphorylation sites

  • Transmembrane regions

  • Protein-protein interaction interfaces

Validation of mutant phenotypes:

  • Assess protein stability and expression levels

  • Compare biofilm formation between wild-type and mutant strains

  • Evaluate signal transduction capabilities

  • Test environmental adaptation under various conditions

By systematically introducing mutations and characterizing their effects, you can map the functional domains of YvaQ and understand their contribution to signal transduction and B. subtilis adaptation.

How can I develop a B. subtilis strain that overexpresses YvaQ for in vivo functional studies?

Developing B. subtilis strains with controlled YvaQ expression requires careful consideration of promoter selection, integration site, and expression verification:

Expression vector design:

  • Promoter selection: Consider inducible promoters like Pspac (IPTG-inducible) or PxylA (xylose-inducible) for controlled expression.

  • Fusion tags: Incorporate epitope tags (His, FLAG) or fluorescent proteins (GFP, mCherry) for detection and tracking .

  • Ribosome binding site: Optimize the RBS strength to achieve desired expression levels.

Genomic integration strategies:

  • amyE locus: A common neutral integration site in B. subtilis

  • thrC locus: Alternative integration site for multiple constructs

  • Native locus: Consider replacing the native yvaQ gene with the tagged version for physiological expression levels

Expression verification methods:

  • Western blotting using tag-specific antibodies

  • Fluorescence microscopy for GFP/mCherry fusion proteins

  • RT-qPCR to quantify transcript levels

Expression optimization parameters:

  • Inducer concentration (if using inducible promoter)

  • Growth phase dependency

  • Media composition effects

This approach builds on methods successfully used for other B. subtilis proteins, including the TasA protein which has been used as a scaffold for displaying heterologous proteins on B. subtilis biofilms .

How does YvaQ research connect with B. subtilis biofilm formation and probiotic applications?

YvaQ research can be integrated with broader B. subtilis applications in several important ways:

Biofilm regulation connections:
As a putative sensory transducer, YvaQ may influence biofilm formation, a well-studied process in B. subtilis . Investigate potential interactions between YvaQ signaling and the known biofilm regulatory pathways involving the yqxM and eps operons . Sensory proteins often detect environmental cues that trigger biofilm development, making YvaQ a candidate for environmental sensing prior to biofilm initiation.

Probiotic applications:
B. subtilis has recognized probiotic properties and can colonize the gastrointestinal tract of animals . YvaQ may contribute to sensing the GI environment and regulating adaptive responses. Research could focus on how YvaQ affects:

  • Survival during passage through the stomach and intestines

  • Adhesion to intestinal epithelial cells

  • Competitive fitness against pathogens

  • Biofilm formation within the GI tract

Recombinant protein display:
Building on recent developments in displaying heterologous proteins on B. subtilis biofilms , investigate whether YvaQ-based sensory systems could be engineered to respond to specific gut conditions and trigger the display of therapeutic proteins or antigens.

Vaccine delivery systems:
Recent work has demonstrated that recombinant B. subtilis spores can be used for oral immunization, leading to colonization of the gut and development of immune responses against displayed antigens . YvaQ research could contribute to optimizing these systems by improving environmental sensing and adaptive responses within the host.

What methodological approaches can integrate YvaQ studies with B. subtilis strain diversity research?

Integrating YvaQ studies with broader B. subtilis strain diversity research requires approaches that connect protein function to ecological adaptation:

Comparative genomics framework:
Analyze yvaQ gene conservation, variation, and synteny across diverse B. subtilis strains. This approach can reveal whether yvaQ exhibits strain-specific adaptations correlated with particular ecological niches. Previous M-CGH analyses have shown variability in genes involved in environmental sensing across B. subtilis strains , suggesting YvaQ may show similar patterns of adaptive variation.

Experimental evolution studies:

  • Subject wild-type and ΔyvaQ strains to long-term adaptation in specific environments

  • Sequence evolved strains to identify compensatory mutations

  • Perform fitness competition assays between evolved strains

Ecological sampling and characterization:

  • Isolate B. subtilis strains from diverse environments (soil, plant roots, animal GI tracts)

  • Sequence and characterize yvaQ variants

  • Correlate sequence variations with ecological parameters and strain phenotypes

Horizontal gene transfer analysis:
Investigate whether yvaQ shows evidence of horizontal gene transfer, which has been documented in B. subtilis evolution (up to 16% of regions in the B. subtilis 168 genome) . This could reveal whether YvaQ functions are shared across related species through horizontal exchange.

Strain-specific functional analysis:

  • Express yvaQ variants from different strains in a common genetic background

  • Compare functional properties and signaling capabilities

  • Identify strain-specific adaptations in sensory mechanisms

This integrated approach leverages the known diversity within the B. subtilis species to understand how YvaQ may contribute to ecological adaptation across different environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.