Recombinant Bacillus subtilis Putative sigma L-dependent transcriptional regulator yqiR (yqiR)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Bacillus subtilis Putative sigma L-dependent Transcriptional Regulator yqiR (yqiR)

Bacillus subtilis yqiR, now referred to as bkdR, encodes a regulator featuring a central catalytic domain . It functions as a transcriptional activator dependent on sigma L . Sigma factors are crucial for transcription initiation in bacteria, guiding RNA polymerase to specific promoter regions on DNA .

Function of yqiR/bkdR

The bkdR gene controls the utilization of isoleucine and valine as sole nitrogen sources . Seven genes located downstream from bkdR—formerly yqiS, yqiT, yqiU, yqiV, bfmBAA, bfmBAB, and bfmBB, and now ptb, bcd, buk, lpd, bkdA1, bkdA2, and bkd—are similar to phosphate butyryl coenzyme A transferase, leucine dehydrogenase, butyrate kinase, and four components of the branched-chain keto acid dehydrogenase complex: E3 (dihydrolipoamide dehydrogenase), E1alpha (dehydrogenase), E1beta (decarboxylase), and E2 (dihydrolipoamide acyltransferase) .

Role in bkd Operon Regulation

The seven genes downstream of bkdR appear to be organized as an operon, bkd, which is transcribed from a -12, -24 promoter . Expression of the bkd operon is induced by isoleucine or valine in the growth medium and depends on the presence of the sigma factor SigL . Transcription of this operon is abolished in strains containing a null mutation in the regulatory gene bkdR . Upstream activating sequences are involved in the expression of the bkd operon and are probably the target of bkdR . Transcription of the bkd operon is also negatively controlled by CodY, a global regulator of gene expression in response to nutritional conditions .

Protein Structure

Proteins are composed of amino acid chains linked to form polypeptides, with their specific sequence dictating their unique shapes . Amino acids are joined by covalent bonds, known as peptide bonds, between the carboxyl group carbon atom of one amino acid and the amino group nitrogen atom of the next adjacent amino acid . The final protein shape (for a single polypeptide or simple protein) is called tertiary structure and is caused by the numerous interactions of R groups on the amino acids and of the protein with its environment, which is usually aqueous (water based) .

Recombinant Production

Recombinant B. subtilis can promote the proliferation of immune cells and stimulate a strong antigen-specific immune response . Recombinant proteins are produced by introducing the gene encoding the protein of interest into a host organism, such as E. coli, which then produces the protein .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1–1.0 mg/mL. For long-term storage, we recommend adding 5–50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yqiR; BSU24100; Putative sigma L-dependent transcriptional regulator YqiR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-692
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yqiR
Target Protein Sequence
MQKVLIVGAGKRGTALLHILIKTAIIDIIAVVDKDPEAPGLKEAEQYGIAVSSDWKPYIQ QKPDIVIHTTGDQAVFDELLQRKHEDTIVMPGKMAYIVFQLMEEKQHLIQMLKEQTYKYD RIFNSTHDGMIFIDINEEIILFNHMAEKMVGKKREEVIGRPIKEVIPSTKMPRILKTRVP EYNQKQLLGDHLQIVTTRLPIIDEGGRLLGALCVFKDITDAVELAEEVTNLKQVRTMLEA IIQSSDEAISVVDENGIGLLINKAYTKMTGLSEKEVIGKPANTDISEGESMHLKVLETRR PVRGVRMKVGPNEKEVIVNVAPVIVDGILKGSVGVIHDVSEIKMLTAELNRARQIIRTLE AKYTFDDIIGKSEQMLVALEQAKLGAKTPATILLRGESGTGKELFAHAIHNESDRKYNKF IRVNCAALSENLLESELFGYEDGAFSGAKRGGKKGLFEEANNGSIFLDEIGELTQNMQAK LLRVLQEKEIVRVGGTKAIPVNVRVIAATNVNIEKAMADGTFREDLYYRINRYPISIPPL RQRLEDIEALSVRLIQKINRDYGRNVKGLSQQALRALSAYHWPGNVRELENVLGRAMIFL NPHMEWIEKDHLPVFELEQKENDTDQGTGFDFPDIEGEKLSVAVEKFEAHLIQQTLEKHH FNRTKTAKALGVSIRNLYYKMDKYGLANEGMQ
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the current nomenclature for the yqiR gene in Bacillus subtilis?

The gene formerly known as yqiR has been renamed bkdR in Bacillus subtilis. This redesignation occurred following the characterization of its function as a transcriptional regulator controlling branched-chain amino acid utilization. When planning experiments or searching literature, researchers should be aware of both designations as older publications may refer to the gene as yqiR while newer studies use bkdR .

What is the functional role of the bkdR (formerly yqiR) protein in Bacillus subtilis?

The bkdR protein functions as a regulatory protein with a central catalytic domain that controls the utilization of isoleucine and valine as sole nitrogen sources in B. subtilis. It acts as a positive transcriptional regulator for a cluster of seven downstream genes (ptb, bcd, buk, lpd, bkdA1, bkdA2, and bkdB) that were previously designated with yqi prefixes. This regulatory cascade enables B. subtilis to adapt its metabolism in response to nitrogen availability by activating genes involved in branched-chain amino acid utilization .

How does the sigma L factor relate to bkdR function?

The sigma L factor (SigL) in B. subtilis is homologous to members of the RpoN family of sigma factors. SigL-dependent promoters lack typical -10 and -35 sequences but contain a conserved TGGCAC-N5-TTGCA sequence centered at positions -12 and -24. These promoters require positive regulatory proteins with a central catalytic domain, such as bkdR, which interact with upstream activating sequences (UAS) to stimulate the isomerization of closed complexes between RNA polymerase and promoter DNA to open complexes, enabling transcription initiation .

What genes are regulated by bkdR in B. subtilis?

BkdR regulates a cluster of seven genes that are positioned downstream from the bkdR gene itself. These genes and their current nomenclature are:

Former NameCurrent NameEncoded Function
yqiSptbPhosphate butyryltransferase
yqiTbcdBranched-chain α-keto acid dehydrogenase
yqiUbukButyrate kinase
yqiVlpdLipoamide dehydrogenase
bfmBAAbkdA1Branched-chain α-keto acid dehydrogenase subunit E1α
bfmBABbkdA2Branched-chain α-keto acid dehydrogenase subunit E1β
bfmBBbkdBBranched-chain α-keto acid dehydrogenase subunit E2

This gene cluster collectively enables B. subtilis to metabolize branched-chain amino acids as alternative nitrogen sources .

How do researchers differentiate between direct and indirect targets of bkdR regulation?

To differentiate between direct and indirect targets of bkdR regulation, researchers typically employ a multi-faceted approach:

  • Chromatin Immunoprecipitation followed by sequencing (ChIP-seq) using tagged bkdR protein to identify genomic binding sites

  • Electrophoretic Mobility Shift Assays (EMSA) to confirm direct DNA binding to predicted promoter regions

  • DNase I footprinting to precisely map the binding sites

  • Transcriptome analysis comparing wild-type and bkdR deletion strains under different nitrogen conditions

  • Construction of promoter-reporter fusions with systematic mutations in predicted binding sites

For putative direct targets, researchers should identify conserved sequence motifs matching the expected binding profile of bkdR, validate binding in vitro, and demonstrate loss of regulation in strains with mutations in either bkdR or its binding sites .

What experimental approaches are most effective for studying the interaction between bkdR and SigL?

The interaction between bkdR and SigL can be effectively studied using:

  • Bacterial two-hybrid assays to detect protein-protein interactions

  • Co-immunoprecipitation experiments with tagged proteins to confirm interactions in vivo

  • Surface plasmon resonance to measure binding kinetics and affinity

  • In vitro transcription assays with purified components (RNA polymerase, SigL, bkdR) to demonstrate functional cooperation

  • Mutational analysis of both proteins to identify interaction domains

Particularly informative is the reconstitution of the transcription initiation complex in vitro, combining purified RNA polymerase, SigL, bkdR, and template DNA containing a SigL-dependent promoter. Researchers can then analyze complex formation using gel filtration, electron microscopy, or crosslinking approaches to elucidate the molecular architecture of the functional complex .

How can researchers assess the physiological impact of bkdR deletion or overexpression in B. subtilis?

To assess the physiological impact of bkdR manipulation, researchers should:

  • Generate clean deletion and controlled overexpression strains using site-specific recombination systems

  • Perform growth curve analysis in minimal media with different nitrogen sources (particularly isoleucine and valine)

  • Conduct metabolomic profiling to detect changes in branched-chain amino acid intermediates

  • Measure expression of downstream target genes using RT-qPCR or RNA-seq

  • Assess stress resistance profiles (particularly nitrogen starvation)

  • Analyze cellular morphology and ultrastructure using microscopy techniques

A comprehensive approach would include measuring the activities of key metabolic enzymes in the branched-chain amino acid degradation pathway, such as phosphate butyryltransferase (encoded by ptb) and branched-chain α-keto acid dehydrogenase (encoded by bcd), under various growth conditions in wild-type, deletion, and overexpression strains .

What are the most reliable methods for generating recombinant bkdR protein for in vitro studies?

For producing recombinant bkdR protein:

  • Clone the bkdR gene into an expression vector with an appropriate affinity tag (His6, GST, or MBP)

  • Express in E. coli BL21(DE3) or similar expression strain

  • Optimize expression conditions by testing different temperatures (16-37°C), IPTG concentrations (0.1-1.0 mM), and durations (3-16 hours)

  • Perform affinity chromatography for initial purification

  • Apply secondary purification methods such as ion exchange and size exclusion chromatography

  • Verify protein activity through DNA binding assays

For functional studies, it's crucial to ensure that the purified bkdR protein retains its native conformation and ability to bind DNA. This can be verified using EMSA with known target promoters. Additionally, researchers should consider expressing the protein with its natural cofactors or adding them during the purification process if they are known to affect protein activity .

How can researchers effectively map bkdR binding sites in the B. subtilis genome?

To map bkdR binding sites:

  • Perform ChIP-seq using antibodies against native bkdR or an epitope-tagged version

  • Analyze the sequencing data to identify enriched regions, which represent potential binding sites

  • Use motif discovery algorithms to identify consensus binding sequences

  • Validate high-confidence binding sites using EMSAs

  • Confirm the functionality of binding sites using reporter gene assays

An alternative approach is DNase I footprinting, which can provide base-pair resolution of protected regions when bkdR binds to DNA. For genome-wide identification of bkdR binding sites, researchers can use DAP-seq (DNA affinity purification followed by sequencing), which involves incubating purified bkdR protein with fragmented B. subtilis genomic DNA, followed by affinity purification and sequencing of bound DNA fragments .

What techniques are most suitable for analyzing the promoter architecture of bkdR-regulated genes?

For analyzing promoter architecture:

  • Primer extension analysis to precisely map transcription start sites

  • Site-directed mutagenesis of putative regulatory elements

  • Creation of promoter truncations fused to reporter genes (e.g., lacZ, gfp)

  • DNase I footprinting to identify protected regions

  • In vitro transcription assays with purified components

Similar to the approach used for analyzing the yqiHIK promoter, researchers can create translational fusions between target gene promoters and reporter genes like lacZ. PCR can be used to introduce restriction sites at various positions upstream of the target gene. The resulting fragments can be cloned into appropriate vectors, creating translational fusions. The activity of these constructs can then be measured under different conditions to identify regions essential for bkdR-dependent regulation .

How should researchers interpret contradictory results between in vitro and in vivo studies of bkdR function?

When faced with contradictory results:

  • Verify experimental conditions and reagents for potential confounding factors

  • Consider the physiological context of in vivo experiments versus purified components in vitro

  • Examine the possibility of additional regulatory factors present in vivo but absent in vitro

  • Assess whether post-translational modifications affect bkdR activity in vivo

  • Investigate potential redundancy or compensatory mechanisms in the bacterial cell

Contradictions often arise from the complex regulatory networks in bacteria. For instance, in B. subtilis, multiple sigma factors can influence gene expression patterns, including SigB which controls stress responses . The cell's physiological state, including energy levels and environmental stressors, can significantly impact regulatory protein function. Researchers should design experiments that systematically address these variables to resolve contradictions .

What statistical approaches are most appropriate for analyzing transcriptome data related to bkdR regulation?

For transcriptome analysis:

  • Apply appropriate normalization methods (e.g., RPKM, TPM, or DESeq2 normalization)

  • Use statistical tests that account for the multiple testing problem (e.g., Benjamini-Hochberg correction)

  • Implement clustering techniques to identify co-regulated genes

  • Perform Gene Ontology (GO) and pathway enrichment analysis

  • Validate key findings using RT-qPCR for a subset of differentially expressed genes

When comparing wild-type and bkdR mutant transcriptomes, researchers should consider using both parametric (t-test, ANOVA) and non-parametric (Wilcoxon, Kruskal-Wallis) tests depending on data distribution. For time-course experiments, specialized methods like STEM (Short Time-series Expression Miner) can identify significant temporal patterns in gene expression. Integration with other omics data, such as proteomics or metabolomics, can provide a more comprehensive understanding of bkdR's regulatory impact .

How does the bkdR regulatory system in B. subtilis compare to similar systems in other Gram-positive bacteria?

The bkdR regulatory system should be compared across species using:

  • Homology searches to identify orthologs in other Gram-positive bacteria

  • Structural alignments of protein domains to assess functional conservation

  • Comparative genomics to examine synteny and operon structure

  • Functional complementation experiments between species

  • Phylogenetic analysis to trace the evolutionary history of the regulatory system

In Gram-positive bacteria like Listeria monocytogenes, Staphylococcus aureus, and other Bacillus species, similar regulatory networks exist but often with notable differences. For example, in B. cereus, B. anthracis, and B. thuringiensis, the energy- and environmental-stress dependent routes of SigB activation differ from those in B. subtilis, utilizing alternative protein modules like the hybrid membrane-bound histidine kinase RsbK and the RsbY protein . Researchers should examine whether similar adaptations exist in the regulation of SigL-dependent genes across these species .

What methodological approaches can be used to identify novel genes regulated by bkdR beyond the known downstream cluster?

To identify novel bkdR targets:

  • Perform RNA-seq comparing wild-type and ΔbkdR strains under various nitrogen conditions

  • Combine with ChIP-seq data to distinguish direct from indirect regulation

  • Use bioinformatic approaches to scan the genome for sequences matching the bkdR binding motif

  • Validate candidates using reporter gene assays and site-directed mutagenesis

  • Employ techniques like CUT&RUN or ATAC-seq to identify changes in chromatin accessibility

A combined approach is most effective, where computational predictions based on sequence motifs are validated experimentally. Researchers should pay particular attention to genes showing differential expression under nitrogen-limiting conditions, as these are most likely to be physiologically relevant targets of bkdR regulation .

What are the most promising approaches for investigating potential cross-talk between bkdR and other regulatory networks in B. subtilis?

To investigate regulatory cross-talk:

  • Construct strains with mutations in multiple regulatory systems (e.g., bkdR and sigB)

  • Perform epistasis analysis to determine hierarchical relationships

  • Use protein-protein interaction methods (bacterial two-hybrid, co-IP) to identify physical interactions

  • Apply network analysis to transcriptome data from various regulatory mutants

  • Develop inducible systems to temporally control expression of different regulators

Recent research has revealed unexpected connections between regulatory networks in B. subtilis. For example, SigB controls the efficiency of spore and biofilm formation through regulation of Spo0E and SinR . Similar connections might exist for bkdR, particularly with other nitrogen-responsive regulators or stress response systems. Investigating these potential interactions could provide insights into how B. subtilis integrates multiple environmental signals to coordinate its transcriptional response .

How might CRISPR-Cas9 technologies be optimized for studying bkdR function in B. subtilis?

CRISPR-Cas9 applications for bkdR research:

  • Design precise gene editing strategies that minimize polar effects on downstream genes

  • Develop CRISPR interference (CRISPRi) systems for tunable repression of bkdR expression

  • Create CRISPR activation (CRISPRa) systems to enhance expression of bkdR or its targets

  • Implement multiplexed CRISPR systems for simultaneous manipulation of bkdR and related regulators

  • Design high-throughput CRISPR screens to identify genetic interactions with bkdR

The CRISPR-Cas9 system has been successfully applied in B. subtilis, as demonstrated in study for other genetic manipulations. For bkdR research, sgRNAs should be carefully designed to avoid off-target effects and achieve the desired genetic modifications. The choice of promoters driving Cas9 and sgRNA expression should be optimized for the specific experimental conditions, particularly when studying nitrogen-responsive systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.