Recombinant Bacillus subtilis Putative transport permease yfiM (yfiM)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Bacillus subtilis putative transport permease YfiM (yfiM) is a membrane-bound protein involved in substrate translocation and antibiotic resistance. As part of the ABC transporter family, YfiM plays critical roles in linearmycin resistance and biofilm regulation. Its recombinant form enables structural, functional, and biotechnological studies.

Table 1: Genomic Context of yfiM

GeneProtein RoleInteraction ScoreFunctional Partners
yfiMPermease subunit0.995YfiL (ATP-binding), YfiJ/YfiK
yfiLATP-binding subunit0.995YfiM, YfiJ/YfiK
yfiJ/KTwo-component regulatory system0.989YfiM, YfiL

Functional Role and Mechanisms

YfiM functions as part of the LnrLMN ABC transporter complex with distinct roles:

  • Linearmycin resistance: Mediates linearmycin efflux via ATP hydrolysis, protecting B. subtilis from streptomycete-produced antibiotics .

  • Biofilm regulation: Modulates biofilm morphology through KinC-dependent signaling, influencing community behavior .

  • Transport mechanism:

    • Substrate binding: Hydrophobic interactions in the TMDs facilitate linearmycin recognition.

    • ATP-driven translocation: YfiL hydrolyzes ATP to induce conformational changes in YfiM, enabling substrate export .

Recombinant Expression Systems

Recombinant YfiM is produced using B. subtilis expression platforms, leveraging its GRAS status and secretion efficiency . Key strategies include:

  • Vector design: Integration of yfiM under strong promoters (e.g., P<sub>grac212</sub>) for cytoplasmic overexpression.

  • Induction: IPTG or self-inducing systems using glucose repression .

  • Purification: Affinity tags (e.g., His-tag) for streamlined isolation .

Table 2: Expression Parameters for Recombinant YfiM

ParameterDetailSource
Host strainB. subtilis BSG1682
Induction methodIPTG or glucose-mediated self-induction
Yield~2–15 mg/L (estimated)

Research Findings

  • Antibiotic resistance: Deletion of yfiM increases susceptibility to linearmycins by >90%, confirming its role in efflux .

  • Biofilm dynamics: YfiM expression correlates with sporulation initiation in biofilms, suggesting a role in community survival .

  • Structural insights: Homology modeling predicts a canonical ABC transporter fold, with TMDs forming a substrate-binding chamber .

Applications and Future Directions

  • Bioremediation: Engineered YfiM variants could enhance toxin export in industrial strains.

  • Antimicrobial development: Targeting YfiM may disrupt linearmycin resistance in pathogenic Bacillus spp.

  • Synthetic biology: Modular integration into biosensors for detecting membrane-active compounds .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly equipped with normal blue ice packs. If you require dry ice shipping, please communicate this need in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lnrM; bifM; yfiM; BSU08320; Linearmycin resistance permease protein LnrM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yfiM
Target Protein Sequence
MKKSIWIAWKDVKIRITDRKGFMMLILMPLILTCILGAALGSVVDGGSRIDDIKVGYIQS DQSDTANMFTKDVLKKMKSIKVTKVGSKDKMKKLIDEKKIDVGIVIPNHWEAGKTSAVVN AAPDQTLKSSIIETAASSFIEQYKAVKEAASGSMDYISKTEAVKQGKLDPAQFAEKLAKT LEKETGDKLTIAEKSVGSKAVTSFQYYSAAMLCMFMLFHITVGAKSFLQEKDTETLARML MTPAQKSVILFGKWLGTYLFAIIQFFIFLIVTINVFGVDWGGNLLLVSVLGLSYAAAVSG ISMLLASCISDMKTADAIGGFGIQLLAVLGGSMLPLYQFPDVLQSVSKAVPNRWALDGFL SLMEGGGWADLQKPVLLFAAIGFCSLVIGIRRLHTR
Uniprot No.

Target Background

Function
Essential for resistance to linearmycins, a family of antibiotic-specialized metabolites produced by certain streptomycetes. This protein is part of the ABC transporter complex LnrLMN, which likely facilitates the removal of linearmycin from the membrane. It is responsible for the translocation of the substrate across the membrane. Additionally, it mediates KinC-dependent biofilm morphology.
Database Links
Protein Families
ABC-2 integral membrane protein family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is yfiM and what is its primary function in Bacillus subtilis?

yfiM is a putative ABC transporter (permease) in Bacillus subtilis that plays a crucial role in antibiotic resistance. It is specifically required for resistance to linearmycins, a family of antibiotic-specialized metabolites produced by some streptomycetes. As part of the ABC transporter complex LnrLMN, yfiM facilitates linearmycin removal from the membrane, being responsible for the translocation of the substrate across the membrane. Additionally, yfiM mediates KinC-dependent biofilm morphology. It belongs to the ABC-2 integral membrane protein family and consists of 396 amino acids .

For experimental characterization, researchers typically employ gene knockout studies followed by linearmycin susceptibility assays. Complementation experiments using wild-type yfiM can confirm phenotype restoration, establishing a direct link between the gene and observed resistance phenotypes.

How does yfiM interact with other proteins in the ABC transporter complex?

yfiM forms a functional complex with at least two other proteins:

ProteinFunctionInteraction with yfiM
yfiLATP-binding proteinProvides energy coupling to the transport system; works in concert with yfiM for substrate translocation
yfiJTwo-component sensor histidine kinasePart of regulatory system involved in linearmycin resistance

The LnrLMN complex represents a typical ABC transporter architecture where yfiM serves as the transmembrane component while yfiL functions as the nucleotide-binding domain. Experimental approaches to study these interactions include bacterial two-hybrid assays, co-immunoprecipitation, and in vitro reconstitution of the purified components to assess functional coupling.

What expression systems are most effective for recombinant yfiM production?

While specific expression data for yfiM is limited, the production of membrane proteins from B. subtilis typically employs the following systems:

Expression HostAdvantagesConsiderations
E. coliHigh yield, well-established protocols, various strains available (BL21, C41/C43 for membrane proteins) May require codon optimization, potential toxicity
Yeast (S. cerevisiae, P. pastoris)Post-translational modifications, eukaryotic membrane environment Longer expression time, more complex media requirements
B. subtilisNative environment, potential for self-regulationLower yields than specialized expression hosts

For membrane proteins like yfiM, expression typically requires optimization of induction parameters (temperature, inducer concentration, duration) to balance protein production with proper membrane insertion.

What purification strategy yields the highest quality recombinant yfiM protein?

Purification of membrane proteins like yfiM requires specialized approaches:

  • Membrane isolation through differential centrifugation

  • Solubilization using appropriate detergents (typically screened empirically)

  • Affinity purification using tags (His-tag purification is common)

  • Size exclusion chromatography for final polishing

Typical purification parameters include:

  • Purity target: >80% by SDS-PAGE

  • Endotoxin levels: <1.0 EU per μg of protein

  • Storage conditions: +4°C for short term, -20°C to -80°C for long term

  • Buffer composition: PBS or similar physiological buffer with stabilizing agents

How can researchers effectively measure yfiM-mediated linearmycin resistance?

Multiple complementary approaches can be used:

  • Minimum inhibitory concentration (MIC) assays comparing wild-type and ΔyfiM strains

  • Zone of inhibition assays in disk diffusion tests

  • Time-kill kinetics to assess the dynamics of resistance

  • Direct measurement of intracellular vs. extracellular linearmycin concentrations using LC-MS/MS

  • Transport assays using fluorescently labeled linearmycin analogs

Controls should include parallel testing with unrelated antibiotics to confirm specificity, and complementation with wild-type yfiM to verify phenotype restoration.

What methods can distinguish between direct and indirect effects of yfiM on linearmycin resistance?

To establish direct mechanistic links between yfiM and linearmycin resistance:

  • In vitro reconstitution of purified yfiM (with yfiL/LnrLMN complex) in proteoliposomes to demonstrate direct transport

  • Substrate binding assays using purified yfiM and labeled linearmycin

  • Site-directed mutagenesis of predicted substrate-binding residues

  • Competition assays with other potential substrates

  • Genetic epistasis experiments with known resistance determinants

These approaches collectively can differentiate between direct transport activity and potential regulatory roles in resistance mechanisms.

What techniques are most informative for determining yfiM membrane topology?

Membrane topology analysis is crucial for understanding yfiM function and can be approached through:

  • Reporter fusion analysis (similar to LacY-PhoA fusions used for E. coli lac permease)

  • Cysteine scanning mutagenesis coupled with accessibility studies

  • Protease protection assays

  • Epitope insertion followed by immunofluorescence in selectively permeabilized cells

  • Computational prediction validated by experimental approaches

The E. coli lac permease studies using alkaline phosphatase fusions offer a methodological template, where fusion junction activities reflect whether regions face the cytoplasm or periplasm .

How can researchers generate structural models of yfiM in the absence of crystal structures?

In the absence of direct structural data:

  • Homology modeling based on related ABC transporters with known structures

  • Ab initio modeling of transmembrane segments

  • Integration of experimental constraints from crosslinking or FRET studies

  • Molecular dynamics simulations to refine models and predict conformational changes

  • Evolutionary coupling analysis to identify co-evolving residues that likely interact structurally

These computational approaches should be validated with experimental data from mutagenesis studies targeting predicted functional residues.

How can yfiM be utilized in synthetic biology applications beyond antibiotic resistance studies?

yfiM's transport capabilities can be exploited for:

  • Development of biosensors for environmental monitoring

  • Engineering strains with enhanced tolerance to toxic compounds

  • Creating selective cellular barriers for compartmentalized biochemical processes

  • Designing export systems for biotechnological products

  • Studying membrane protein evolution through directed evolution experiments

These applications require detailed characterization of substrate specificity and transport kinetics, potentially using techniques described in the experimental evolution of B. subtilis .

What experimental approaches can reveal yfiM's role in biofilm formation and regulation?

To investigate the connection between yfiM and biofilm development:

  • Quantitative biofilm assays comparing wild-type, ΔyfiM, and complemented strains

  • Microscopic analysis of biofilm architecture using confocal microscopy

  • Gene expression studies of biofilm-related genes in yfiM mutants

  • Epistasis analysis with known biofilm regulators, particularly KinC-dependent pathways

  • Matrix component analysis (exopolysaccharides, proteins, extracellular DNA)

B. subtilis serves as an excellent model for biofilm studies, with established protocols for inducing biofilm formation under laboratory conditions .

How can researchers overcome common difficulties in expressing functional recombinant yfiM?

Membrane protein expression challenges often include toxicity, aggregation, and low yields. Potential solutions include:

  • Using tightly regulated induction systems

  • Lowering expression temperature (often 16-20°C optimizes folding)

  • Testing multiple detergents for solubilization

  • Co-expression with chaperones

  • Using fusion partners that enhance folding or membrane targeting

  • Cell-free expression systems as alternatives to in vivo expression

Many researchers employ a parallel screening approach testing multiple constructs and conditions simultaneously to identify optimal expression parameters.

What quality control metrics should be applied to ensure recombinant yfiM is properly folded and functional?

Critical quality assessments include:

Quality ParameterMethodAcceptance Criteria
PuritySDS-PAGE, SEC-MALS>80% purity
HomogeneitySize-exclusion chromatographySingle, symmetric peak
Thermal stabilityDifferential scanning fluorimetryDefined, cooperative unfolding transition
Functional activitySubstrate binding or transport assaysActivity comparable to native protein
Secondary structureCircular dichroismProfile consistent with predicted α-helical content
Oligomeric stateAnalytical ultracentrifugationConsistent with predicted quaternary structure

How might high-throughput methods advance understanding of yfiM substrate specificity?

Next-generation approaches include:

  • Development of fluorescence-based transport assays adaptable to microplate format

  • Metabolomic profiling comparing wild-type and ΔyfiM strains exposed to various compounds

  • Chemogenomic profiling to identify genetic interactions

  • Deep mutational scanning to map functional residues across the entire protein

  • Computational screening of molecular libraries coupled with experimental validation

Such approaches could reveal previously unknown substrates and functions of yfiM beyond linearmycin resistance.

What experimental designs would best elucidate the evolutionary significance of yfiM in environmental adaptation?

To understand evolutionary aspects:

  • Comparative genomics across Bacillus species to track yfiM conservation

  • Experimental evolution studies under linearmycin selection pressure

  • Horizontal gene transfer experiments to assess transmission of resistance phenotypes

  • Fitness measurements in various environmental conditions

  • Testing yfiM function in the context of microbial communities

The experimental evolution approach used with B. subtilis under high salinity stress could serve as a methodological template, particularly for studying how natural competence might influence yfiM evolution .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.