Recombinant Bacillus subtilis Putative transport permease yfiN (yfiN)

Shipped with Ice Packs
In Stock

Description

Genomic Context

yfiN is located adjacent to padR (a phenolic acid decarboxylase regulator) and yveFG-padC operon in B. subtilis . This proximity suggests potential regulatory or functional links to phenolic acid metabolism or membrane transport.

Homology and Predicted Function

  • ABC Transporter Family: yfiN shares structural similarities with ATP-binding cassette (ABC) transporters, which typically mediate substrate translocation across membranes .

  • Regulatory Interactions: In B. subtilis, padR regulates the yveFG-padC operon in response to phenolic acids, though yfiN’s role in this pathway remains uncharacterized .

Production Systems

SystemAdvantagesLimitationsSource
E. coliHigh yield, cost-effectiveRisk of protease degradation
BaculovirusProper post-translational modificationsLower throughput

Applications in Biotechnology

While yfiN’s biological function is unresolved, its recombinant form serves as a tool in:

  • Membrane Transport Studies: Investigating ABC transporter mechanisms .

  • Protein Production Platforms: Leveraging B. subtilis’s GRAS status for scalable recombinant protein synthesis .

  • Structural Biology: Crystallization or cryo-EM studies to elucidate transmembrane domain interactions .

Challenges and Future Directions

  • Functional Elucidation: Limited experimental data on substrate specificity or transport activity.

  • Optimization: Enhancing solubility and stability in recombinant systems .

  • Industrial Relevance: Potential use in bioremediation or biofuel production, contingent on functional characterization.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lnrN; bifN; yfiN; BSU08330; Linearmycin resistance permease protein LnrN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-385
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yfiN
Target Protein Sequence
MKKILAICGIELSLIFKKPQNYLIMFAAPLLLTFVFGSMLSGNDDKVRLAIVDQDDTILS QHYIRQLKAHDDMYVFENMSESKASEKLKQKKIAGIIVISRSFQTQLEKGKHPELIFRHG PELSEAPMVKQYAESALATLNIQVTAAKTASQTAGENWKAAYKTVFAKKHEDIVPAVTRQ TLSDKKEGAEASDTASRAAGFSILFVMLTMMGAAGTILEARKNGVWSRLLTASVSRAEIG AGYVLSFFVIGWIQFGILLLSTHWLFGINWGNPAAVIVLVSLFLLTVVGIGLMIAANVRT PEQQLAFGNLFVIATCMVSGMYWPIDIEPKFMQSIAEFLPQKWAMSGLTEIIANGARVTD ILGICGILLAFAAITFAAGLKALRA
Uniprot No.

Target Background

Function
Essential for resistance to linearmycins, a family of antibiotic-specialized metabolites produced by certain streptomycetes. This protein is part of the ABC transporter complex LnrLMN, which likely facilitates linearmycin removal from the membrane. It is responsible for translocating the substrate across the membrane. Additionally, it mediates KinC-dependent biofilm morphology.
Database Links
Protein Families
ABC-2 integral membrane protein family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus subtilis and why is it important as a host organism for recombinant protein expression?

Bacillus subtilis is a ubiquitous, Gram-positive, rod-shaped bacterium commonly found in soil, water, air, and decomposing plant material. It has gained significant attention in the scientific community for several key reasons:

  • It produces endospores that allow it to endure extreme conditions of heat and desiccation in the environment .

  • It has received GRAS (Generally Recognized As Safe) status, making it suitable for various biotechnological applications .

  • It offers favorable culturing characteristics for large-scale fermentation .

  • It has superior capacity for protein secretion compared to many other expression systems .

  • It is easily amenable to genetic manipulation .

These characteristics make B. subtilis an ideal host for recombinant protein expression, particularly for proteins that benefit from secretion into the extracellular medium rather than accumulating intracellularly.

What are the general characteristics of transport permeases in Bacillus subtilis?

Transport permeases in B. subtilis are integral membrane proteins that facilitate the movement of specific molecules across the cellular membrane. Their general characteristics include:

  • They contain multiple transmembrane domains that form channels or pores through the lipid bilayer.

  • They often function in concert with ATP-binding cassette (ABC) transporters or other energy-coupling factors.

  • Many are regulated at the transcriptional level in response to environmental signals.

  • They play crucial roles in nutrient acquisition, waste removal, and maintaining cellular homeostasis.

  • They can be classified based on their substrate specificity, energy requirements, and structural features.

Transport permeases contribute significantly to the adaptability of B. subtilis to various environmental conditions by controlling the influx and efflux of molecules across the cell membrane.

How does the SubtiList database contribute to research on B. subtilis proteins like YfiN?

SubtiList serves as the reference database dedicated to the B. subtilis genome, providing valuable resources for researchers studying specific proteins like the putative transport permease YfiN:

  • It offers continuously updated datasets of DNA and protein sequences linked to relevant annotations and functional assignments .

  • It provides a user-friendly, specialized interface accessible through the World Wide Web .

  • It includes cross-references to other B. subtilis-dedicated data collections such as Sub2D (proteomic resource), Micado (phenotypic resource), and JAFAN (Japanese functional analysis resource) .

  • It incorporates regulatory data extracted from gene annotations and relevant literature .

  • It features documentary information including illustrations of complex regulatory systems or cellular processes dynamically linked to relevant genes .

The database regularly updates gene functions based on recent literature and personal communications from researchers, which has led to renaming many genes that previously had unknown functions (designated with 'y' prefixes) . This ongoing curation makes SubtiList an essential tool for researchers investigating putative proteins like YfiN.

What are the most effective methods for cloning and expressing the yfiN gene in Bacillus subtilis?

For efficient cloning and expression of yfiN in B. subtilis, researchers should consider the following methodological approach:

  • Gene isolation and primer design:

    • Design specific primers for the yfiN gene based on the B. subtilis genome sequence available in SubtiList .

    • Include appropriate restriction sites for subsequent cloning steps.

  • PCR amplification and cloning:

    • Extract genomic DNA from B. subtilis strain 168 (the paradigm strain) .

    • Perform PCR amplification of the yfiN gene.

    • Clone the amplified product into a T/A vector for sequence verification .

  • Expression vector construction:

    • Select an appropriate B. subtilis expression vector containing:

      • A strong promoter (e.g., Cyt1 promoter, which has been successfully used for other recombinant proteins)

      • A signal peptide if secretion is desired

      • Selection markers compatible with B. subtilis

  • Transformation and expression:

    • Transform the constructed vector into a suitable B. subtilis strain (e.g., strain KO7, which has been used for recombinant protein expression) .

    • Culture the transformants in optimized medium such as NBG medium .

    • Induce expression according to the selected promoter system.

  • Protein analysis:

    • Confirm expression by SDS-PAGE analysis .

    • Verify functionality through transport assays specific to the predicted substrate.

This methodology provides a systematic approach to studying the YfiN permease while taking advantage of B. subtilis' favorable characteristics for recombinant protein expression.

What strategies can be employed to optimize the expression levels of membrane proteins like YfiN in B. subtilis?

Optimizing expression of membrane proteins like YfiN presents unique challenges. Consider these research-proven strategies:

  • Promoter selection and modification:

    • Use inducible promoters that allow tight regulation to prevent toxicity associated with membrane protein overexpression.

    • Consider the Cyt1 promoter, which has shown success in expressing recombinant proteins in B. subtilis .

  • Codon optimization:

    • Analyze the codon usage patterns in highly expressed B. subtilis genes.

    • Optimize the yfiN coding sequence accordingly, while maintaining regulatory elements.

  • Signal sequence engineering:

    • Evaluate various signal peptides for optimal membrane insertion.

    • Consider the signal peptide-dependent protein transport mechanisms specific to B. subtilis .

  • Host strain selection:

    • Use protease-deficient strains to minimize degradation of the target protein.

    • Consider strains with modified secretion machinery for enhanced membrane protein expression.

  • Culture conditions optimization:

    • Test various media compositions, including NBG medium which has supported recombinant protein expression .

    • Evaluate temperature, pH, and induction timing effects on expression levels.

    • Consider reduced growth temperatures (25-30°C) to slow protein synthesis and facilitate proper folding.

  • Co-expression strategies:

    • Co-express chaperones that assist in membrane protein folding.

    • Consider expressing protein fragments separately if the full-length protein proves difficult to express.

Systematic optimization of these parameters will help achieve sufficient YfiN expression levels for structural and functional studies.

How can researchers accurately assess the localization and membrane integration of YfiN in B. subtilis?

Accurate assessment of YfiN localization and membrane integration requires multiple complementary approaches:

  • Subcellular fractionation:

    • Separate cellular components (cytoplasm, membrane, cell wall) through differential centrifugation.

    • Analyze fractions by Western blotting using antibodies against YfiN or an epitope tag.

    • Quantify relative distribution across different cellular compartments.

  • Fluorescence microscopy:

    • Create translational fusions with fluorescent proteins (ensuring functionality is maintained).

    • Visualize localization patterns in living cells under various conditions.

    • Use counter-stains to mark membranes and confirm co-localization.

  • Protease accessibility assays:

    • Expose intact cells, spheroplasts, or membrane vesicles to proteases.

    • Analyze protection patterns to determine topology of YfiN domains.

    • Compare results with in silico topology predictions.

  • Membrane extraction analysis:

    • Treat membranes with buffers containing different detergents or chaotropic agents.

    • Determine extraction conditions that solubilize YfiN to assess its membrane integration strength.

    • Compare with known integral membrane proteins and peripheral proteins as controls.

  • Proteomics approach:

    • Utilize resources like Sub2D, the proteomic database for B. subtilis .

    • Compare experimental data with reference profiles of known membrane proteins.

  • Electron microscopy with immunogold labeling:

    • Use specific antibodies conjugated to gold particles to visualize YfiN localization at ultrastructural level.

    • Analyze distribution patterns across the cell envelope.

This multi-technique approach provides robust evidence for YfiN's subcellular localization and membrane topology, critical for understanding its biological function.

What experimental approaches can determine the substrate specificity of the putative transport permease YfiN?

Determining substrate specificity of YfiN requires a systematic approach combining genetic, biochemical, and physiological methods:

  • Genetic approaches:

    • Generate yfiN deletion mutants and assess phenotypic changes.

    • Perform complementation studies with wild-type and mutated versions of yfiN.

    • Create conditional expression strains to study gene dosage effects.

  • Transport assays:

    • Develop radioactive or fluorescently labeled substrate uptake assays.

    • Use membrane vesicles or proteoliposomes containing purified YfiN.

    • Measure transport kinetics with various potential substrates.

    • Determine inhibition patterns with structural analogs.

  • Growth phenotype analysis:

    • Test growth of wild-type and ΔyfiN strains on minimal media with different nutrient sources.

    • Assess sensitivity to various toxic compounds that might be exported by YfiN.

    • Perform high-throughput phenotype microarray analysis to identify conditions affected by yfiN deletion.

  • Comparative genomics:

    • Analyze YfiN homologs in related bacteria with known functions.

    • Examine genomic context of yfiN for potential clues (neighboring genes often have related functions).

    • Utilize SubtiList database to investigate potential functional associations .

  • Structural prediction and docking studies:

    • Generate 3D models of YfiN based on related transporters with known structures.

    • Perform in silico docking studies with potential substrates.

    • Design mutations of predicted substrate-binding residues for experimental validation.

  • Metabolomic analysis:

    • Compare metabolite profiles of wild-type and ΔyfiN strains.

    • Identify accumulated compounds that might represent substrates or their derivatives.

This multifaceted approach provides converging evidence to accurately define YfiN's substrate specificity and transport mechanism.

How does the expression of YfiN vary under different environmental conditions, and what regulatory mechanisms control its expression?

Understanding YfiN's expression patterns and regulatory mechanisms requires comprehensive analysis:

  • Transcriptional profiling:

    • Perform RNA-seq or qRT-PCR analysis under various growth conditions.

    • Test different nutrient limitations, stress conditions, growth phases, and environmental factors.

    • Identify conditions that significantly alter yfiN expression.

  • Promoter analysis:

    • Clone the yfiN promoter region upstream of reporter genes (e.g., lacZ, gfp).

    • Measure reporter activity under various conditions.

    • Perform promoter deletion and mutation analysis to identify regulatory elements.

  • Identification of transcription factors:

    • Use electrophoretic mobility shift assays (EMSA) to identify proteins binding to the yfiN promoter.

    • Perform chromatin immunoprecipitation (ChIP) experiments to verify binding in vivo.

    • Integrate findings with known regulatory networks in B. subtilis.

  • Regulatory database integration:

    • Utilize the regulation data from SubtiList and DBTBS (database of transcriptional regulation in B. subtilis) .

    • Compare yfiN regulation with other genes in similar functional categories.

  • Post-transcriptional regulation:

    • Analyze mRNA stability under different conditions.

    • Investigate potential sRNA-mediated regulation.

    • Examine ribosome binding site accessibility and potential translational control.

  • Protein level regulation:

    • Develop antibodies or tagged versions of YfiN to monitor protein levels.

    • Investigate protein stability and degradation mechanisms.

    • Assess post-translational modifications that might affect activity.

This comprehensive analysis provides insights into when and why B. subtilis expresses YfiN, offering clues to its physiological role and potential applications in recombinant systems.

What role does YfiN play in B. subtilis stress response and adaptation to changing environments?

Investigating YfiN's role in stress response requires a systematic research approach:

  • Stress survival assays:

    • Compare wild-type and ΔyfiN strains under various stresses:

      • Osmotic stress (high salt, sugar)

      • Oxidative stress (H₂O₂, paraquat)

      • pH stress (acidic/alkaline conditions)

      • Antibiotic challenge

      • Temperature extremes

      • Nutrient limitation

  • Competitive fitness experiments:

    • Co-culture wild-type and ΔyfiN strains under fluctuating conditions.

    • Track population dynamics over multiple generations.

    • Assess relative fitness advantages/disadvantages in specific environments.

  • Sporulation and germination analysis:

    • Measure sporulation efficiency in the ΔyfiN mutant.

    • Assess spore resistance properties and germination kinetics.

    • Investigate YfiN's potential role in the transition between vegetative growth and sporulation .

  • Biofilm formation:

    • Compare biofilm development between wild-type and ΔyfiN strains.

    • Analyze matrix composition and architectural differences.

    • Assess biofilm resistance to environmental challenges.

  • Global response integration:

    • Perform transcriptome and proteome analysis of ΔyfiN mutants under stress.

    • Identify pathways affected by YfiN absence.

    • Map YfiN's position in known stress response networks.

  • Metabolic flux analysis:

    • Trace metabolite flow in wild-type and ΔyfiN strains under stress.

    • Identify metabolic bottlenecks that may develop in the absence of YfiN.

    • Connect transport function to broader metabolic adaptation strategies.

This research framework helps define YfiN's contribution to B. subtilis' remarkable adaptability to changing environments, potentially revealing new applications for this bacterial transport system in biotechnology.

How can structural biology techniques be applied to elucidate the three-dimensional structure of YfiN?

Determining the structure of membrane proteins like YfiN requires specialized approaches:

This multi-technique approach maximizes the chances of successfully determining YfiN's structure, providing crucial insights for understanding its transport mechanism and substrate specificity.

What are the potential applications of engineered YfiN variants in biotechnology and pharmaceutical research?

Engineered YfiN variants offer several promising research applications:

  • Enhanced recombinant protein secretion systems:

    • Modify YfiN to optimize transport of specific classes of proteins.

    • Integrate engineered YfiN into existing B. subtilis expression systems to improve protein yields.

    • Leverage B. subtilis' GRAS status for pharmaceutical protein production .

  • Biosensor development:

    • Engineer substrate-binding domains to detect specific molecules.

    • Couple transport activity to reporter systems for real-time monitoring.

    • Develop whole-cell biosensors for environmental monitoring or diagnostics.

  • Drug delivery systems:

    • Incorporate YfiN into liposomes or nanoparticles for controlled release of therapeutics.

    • Exploit substrate specificity for targeted drug delivery.

    • Use in conjunction with B. subtilis spores as delivery vehicles to specific tissues .

  • Antimicrobial development:

    • Target homologous transporters in pathogenic bacteria.

    • Design inhibitors based on YfiN structure and mechanism.

    • Exploit YfiN to enhance uptake of antimicrobial compounds into bacterial cells.

  • Bioremediation applications:

    • Engineer YfiN variants that transport environmental pollutants.

    • Develop B. subtilis strains with enhanced ability to sequester or metabolize toxins.

    • Utilize B. subtilis' natural soil habitat for in situ bioremediation .

  • Metabolic engineering platforms:

    • Incorporate modified YfiN to control flux of specific metabolites.

    • Enhance production of valuable compounds by facilitating precursor uptake or product export.

    • Integrate with existing B. subtilis metabolic engineering tools.

This research direction connects fundamental understanding of transport mechanisms with practical applications, potentially yielding new biotechnological tools and therapeutic approaches.

How does the function of YfiN compare across different Bacillus species and other related Gram-positive bacteria?

Comparative analysis of YfiN across bacterial species provides evolutionary and functional insights:

  • Phylogenetic analysis:

    • Construct comprehensive phylogenetic trees of YfiN homologs.

    • Map functional variations onto evolutionary relationships.

    • Identify conserved domains and species-specific adaptations.

    • Use SubtiList database as a starting point for B. subtilis data .

  • Comparative genomics:

    • Analyze gene neighborhood conservation across species.

    • Identify co-evolved gene clusters that might indicate functional relationships.

    • Compare regulatory elements in promoter regions across species.

  • Heterologous expression studies:

    • Express YfiN homologs from different species in a common B. subtilis host.

    • Compare substrate specificities and transport efficiencies.

    • Identify species-specific factors required for functional expression.

  • Domain swapping experiments:

    • Create chimeric proteins with domains from different species.

    • Map species-specific functional determinants to specific protein regions.

    • Correlate structural differences with functional variations.

  • Ecological and physiological context:

    • Correlate YfiN variations with species-specific ecological niches.

    • Analyze adaptations to particular environmental pressures.

    • Consider the relationship between YfiN function and species-specific metabolic capabilities.

  • Experimental evolution:

    • Subject B. subtilis to conditions mimicking other species' habitats.

    • Track adaptive mutations in yfiN under selection pressure.

    • Test whether evolved variants converge on features seen in other species.

This research approach reveals how transport functions adapt to different ecological niches and physiological requirements across bacterial species, providing insights into both evolutionary processes and potential biotechnological applications.

What are the main challenges in purifying functional YfiN for biochemical and structural studies?

Purifying membrane proteins like YfiN presents specific challenges requiring specialized approaches:

  • Expression level limitations:

    • Challenge: Membrane proteins often express at lower levels than soluble proteins.

    • Solution: Optimize expression using strong, tightly regulated promoters like Cyt1 , adjust growth temperature, and consider specialized B. subtilis strains with enhanced membrane protein expression capabilities.

  • Membrane extraction efficiency:

    • Challenge: Removing YfiN from its native membrane environment while maintaining structure.

    • Solution: Screen multiple detergents systematically (non-ionic, zwitterionic, etc.) at various concentrations and temperatures to identify optimal solubilization conditions.

  • Protein stability issues:

    • Challenge: Maintaining YfiN stability outside the membrane environment.

    • Solution: Include appropriate lipids during purification, use stabilizing additives, and consider nanodiscs or amphipols as membrane mimetics.

  • Purification yields:

    • Challenge: Obtaining sufficient quantities for structural studies.

    • Solution: Scale up culture volumes, optimize each purification step for recovery, and consider affinity tags strategically placed to avoid interference with function.

  • Functional assessment:

    • Challenge: Verifying that purified YfiN retains native activity.

    • Solution: Develop robust functional assays with reconstituted proteoliposomes to verify transport activity is preserved throughout purification.

  • Conformational heterogeneity:

    • Challenge: Membrane transporters often exist in multiple conformational states.

    • Solution: Use ligands, inhibitors, or mutations to lock YfiN in specific conformations, improving sample homogeneity for structural studies.

This methodical approach to purification challenges maximizes the chances of obtaining functional YfiN suitable for detailed biochemical and structural characterization.

How can researchers differentiate between the functional roles of YfiN and other transporters with potentially overlapping functions?

Distinguishing YfiN's specific functions from other transporters requires careful experimental design:

  • Combined deletion approach:

    • Create single, double, and multiple deletion strains of yfiN and related transporters.

    • Perform phenotypic analysis to identify unique vs. redundant functions.

    • Quantify the contribution of each transporter to specific processes.

  • Substrate competition assays:

    • Measure transport of labeled substrates in the presence of potential competitors.

    • Compare substrate specificity profiles across different transporters.

    • Determine kinetic parameters (Km, Vmax) for shared substrates.

  • Expression regulation analysis:

    • Compare expression patterns of yfiN and related transporters across conditions.

    • Identify unique regulatory signals for each transporter.

    • Use SubtiList and DBTBS databases to analyze regulatory networks .

  • Domain-specific functional analysis:

    • Identify unique structural features of YfiN compared to related transporters.

    • Create chimeric proteins by domain swapping between YfiN and other transporters.

    • Map functional specificity to particular protein domains.

  • High-resolution physiological studies:

    • Use microfluidics coupled with single-cell analysis to detect subtle phenotypic differences.

    • Measure metabolite fluxes at high temporal resolution during environmental transitions.

    • Identify conditions where YfiN plays a dominant role vs. conditions where other transporters compensate.

  • Evolutionary conservation analysis:

    • Compare conservation patterns of YfiN vs. other transporters across Bacillus species.

    • Identify species that have YfiN but lack particular related transporters (or vice versa).

    • Correlate transporter repertoire with ecological adaptations.

This systematic approach distinguishes the unique contributions of YfiN from the background of related transport functions, essential for understanding its specific biological role.

What are the current limitations in our understanding of YfiN function, and what experimental approaches might address these knowledge gaps?

Current knowledge gaps and potential research strategies include:

  • Precise substrate specificity:

    • Knowledge gap: The exact molecules transported by YfiN remain speculative.

    • Research approach: Combine transport assays with metabolomics to identify transported molecules. Use membrane vesicles or proteoliposomes containing purified YfiN to test candidate substrates systematically.

  • Transport mechanism:

    • Knowledge gap: The bioenergetic coupling and conformational changes during transport are unknown.

    • Research approach: Perform site-directed mutagenesis of potential energy-coupling residues. Use EPR spectroscopy or FRET to track conformational changes during the transport cycle.

  • Physiological role integration:

    • Knowledge gap: How YfiN activity coordinates with broader cellular processes remains unclear.

    • Research approach: Perform systems-level analysis combining transcriptomics, proteomics, and metabolomics in wild-type and ΔyfiN strains under various conditions. Use resources like SubtiList to integrate findings with existing knowledge .

  • Regulatory networks:

    • Knowledge gap: The complete set of factors controlling yfiN expression is unknown.

    • Research approach: Perform ChIP-seq to identify transcription factors binding the yfiN promoter. Screen transcription factor deletion libraries for effects on yfiN expression.

  • Protein-protein interactions:

    • Knowledge gap: Potential interaction partners that modulate YfiN function are unidentified.

    • Research approach: Perform pull-down assays, bacterial two-hybrid screening, or proximity labeling to identify interaction partners. Validate interactions through co-immunoprecipitation and functional studies.

  • Structural basis of function:

    • Knowledge gap: The three-dimensional structure and structure-function relationships are undefined.

    • Research approach: Apply structural biology techniques (X-ray crystallography, cryo-EM) to determine YfiN structure. Perform extensive mutagenesis to map functional residues.

This research framework systematically addresses fundamental questions about YfiN, providing a roadmap for investigators to fill critical knowledge gaps and advance understanding of this putative transport permease.

What bioinformatic approaches can predict YfiN structure, function, and evolutionary relationships?

Modern bioinformatic methods offer powerful tools for YfiN analysis:

  • Sequence-based predictions:

    • Transmembrane topology prediction: Apply algorithms like TMHMM, Phobius, and TOPCONS to predict membrane-spanning regions.

    • Functional domain identification: Use Pfam, SMART, and InterPro to identify conserved domains and potential functional motifs.

    • Signal sequence analysis: Predict potential signal peptides using SignalP, particularly relevant for B. subtilis protein transport .

  • Structural prediction approaches:

    • Homology modeling: Identify structural homologs using HHpred or Phyre2, even with low sequence identity.

    • Ab initio and deep learning methods: Apply AlphaFold2 or RoseTTAFold for predictions when close homologs are unavailable.

    • Molecular dynamics simulations: Refine models and study dynamics in membrane environments.

  • Evolutionary analysis:

    • Phylogenetic reconstruction: Build maximum likelihood or Bayesian phylogenies of YfiN homologs.

    • Coevolution analysis: Identify co-evolving residues likely involved in substrate binding or conformational changes.

    • Selective pressure analysis: Calculate dN/dS ratios to identify residues under positive or purifying selection.

  • Genomic context analysis:

    • Gene neighborhood conservation: Analyze conserved gene clusters across species using tools like SyntTax.

    • Regulon prediction: Identify potential co-regulated genes using comparative genomics approaches.

    • Utilize SubtiList: Leverage this B. subtilis genomic database for comprehensive analysis .

  • Network-based approaches:

    • Protein-protein interaction prediction: Use tools like STRING to predict functional associations.

    • Metabolic network integration: Map YfiN function to existing metabolic models of B. subtilis.

    • Cross-species network comparison: Identify conserved network motifs across bacterial species.

These bioinformatic approaches provide testable hypotheses about YfiN function, guiding experimental design and interpretation while maximizing research efficiency.

How should researchers interpret contradictory experimental results regarding YfiN function?

When facing contradictory results about YfiN function, apply this systematic framework:

  • Methodological considerations:

    • Experimental conditions: Compare precise growth conditions, media components, and environmental factors between studies.

    • Strain background effects: Assess whether different B. subtilis strains were used, as genetic background can influence results.

    • Technical approach variations: Evaluate differences in experimental techniques, reagents, and analytical methods.

  • Data integration strategies:

    • Hierarchical evidence assessment: Weigh direct biochemical evidence over indirect genetic evidence.

    • Dose-response relationships: Examine whether contradictions might be explained by concentration-dependent effects.

    • Time-course considerations: Determine if apparent contradictions result from measuring outcomes at different time points.

  • Contextual understanding:

    • Condition-dependent functionality: Consider whether YfiN may have different functions under different conditions.

    • Multi-substrate transport: Assess whether YfiN might transport multiple substrates with varying efficiencies.

    • Regulatory feedbacks: Evaluate whether compensatory mechanisms might mask certain phenotypes.

  • Resolving contradictions:

    • Critical control experiments: Design experiments specifically to address the contradiction.

    • Unified experimental platform: Replicate key findings from different studies using identical conditions.

    • Collaboration approach: Engage with researchers reporting contradictory results to identify variables.

  • Advanced analysis frameworks:

    • Mathematical modeling: Develop models that might explain apparently contradictory results.

    • Systems biology integration: Place contradictory results in the context of broader cellular processes.

    • Utilize comprehensive databases: Incorporate information from SubtiList to provide context .

This approach transforms contradictions from obstacles into opportunities for deeper mechanistic understanding of YfiN function.

What statistical methods are most appropriate for analyzing transport kinetics data for YfiN?

Robust statistical analysis of YfiN transport kinetics requires specialized approaches:

  • Kinetic parameter estimation:

    • Non-linear regression: Fit transport data to appropriate kinetic models (Michaelis-Menten, Hill equation, etc.).

    • Global fitting approaches: Simultaneously fit multiple datasets to constrain parameter estimates.

    • Comparison of models: Use Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC) to select between competing kinetic models.

  • Experimental design considerations:

    • Power analysis: Determine appropriate sample sizes to detect meaningful differences in transport rates.

    • Randomized block design: Control for batch effects in vesicle or proteoliposome preparations.

    • Latin square designs: Efficiently test multiple substrates, concentrations, and conditions.

  • Data transformation and validation:

    • Lineweaver-Burk and Eadie-Hofstee plots: Use as diagnostic tools to identify deviations from simple kinetic models.

    • Residual analysis: Examine patterns in residuals to validate model assumptions.

    • Bootstrap methods: Generate confidence intervals for kinetic parameters without assuming normal distribution.

  • Advanced statistical approaches:

    • Mixed-effects models: Account for random variation between experimental batches.

    • Bayesian methods: Incorporate prior knowledge about related transporters into parameter estimation.

    • Monte Carlo simulations: Assess how measurement uncertainties propagate to final parameter estimates.

  • Comparison between conditions:

    • Multiple comparison corrections: Apply Bonferroni or false discovery rate corrections when comparing multiple substrates or conditions.

    • Equivalence testing: Determine whether apparent differences in transport rates are statistically meaningful.

    • Meta-analysis approaches: Combine data across multiple experiments to increase statistical power.

This statistical framework ensures robust, reproducible analysis of YfiN transport data, facilitating comparison across studies and accurate interpretation of experimental results.

What specialized resources and databases are available for researchers studying transport permeases in B. subtilis?

Researchers investigating YfiN and related transporters should utilize these specialized resources:

  • Genomic and proteomic databases:

    • SubtiList: The reference database dedicated to the B. subtilis genome, providing continuously updated DNA and protein sequences with annotations .

    • SubtiWiki: A comprehensive, community-driven resource for B. subtilis genes and proteins.

    • Sub2D: The proteomic resource for B. subtilis referenced in SubtiList, providing experimental proteomic data .

  • Regulatory information:

    • DBTBS: Database of transcriptional regulation in B. subtilis, integrated with SubtiList .

    • Micado: The phenotypic resource for B. subtilis with links to SubtiList .

    • JAFAN: Japanese functional analysis resource linked to SubtiList .

  • Transporter-specific resources:

    • TCDB (Transporter Classification Database): Classification system for membrane transport proteins.

    • TransportDB: Genomic analyses of cellular transport systems across bacterial species.

    • MemProtMD: Database of membrane proteins inserted into explicit lipid bilayers.

  • Structural databases and tools:

    • PDB (Protein Data Bank): Repository of protein structures, including related transporters.

    • SWISS-MODEL: Automated protein structure homology-modeling server.

    • AlphaFold DB: Database of protein structure predictions using AI methods.

  • Functional prediction tools:

    • Pfam: Database of protein families with hidden Markov models for domain identification.

    • InterPro: Integrated database of protein families, domains, and functional sites.

    • KEGG: Kyoto Encyclopedia of Genes and Genomes for metabolic pathway mapping.

  • Experimental protocols and resources:

    • BacillusGeneticStock Center (BGSC): Repository of B. subtilis strains and plasmids.

    • Addgene: Nonprofit plasmid repository with vectors for B. subtilis.

    • PROSITE: Database of protein domains, families, and functional sites.

These resources provide the necessary context, data, and tools for comprehensive investigation of YfiN and related transport permeases in B. subtilis.

How can researchers effectively design collaborative projects to study complex aspects of YfiN function?

Effective collaboration on YfiN research requires structured approaches:

  • Expertise integration framework:

    • Complementary skill mapping: Identify collaborators with expertise in genetics, biochemistry, structural biology, and bioinformatics.

    • Technology access planning: Partner with groups having access to specialized equipment (e.g., cryo-EM, mass spectrometry).

    • Interdisciplinary team formation: Include experts from microbiology, biophysics, and systems biology for comprehensive analysis.

  • Project management strategies:

    • Modular experimental design: Divide research into discrete modules that can progress semi-independently.

    • Clear milestone definition: Establish specific, measurable benchmarks for project progression.

    • Regular synchronization protocols: Implement structured communication schedules with data sharing platforms.

  • Data sharing and integration:

    • Standardized protocols: Develop common experimental procedures to ensure cross-lab reproducibility.

    • Centralized data repository: Create a secure platform for raw data sharing and version control.

    • Common analysis pipelines: Implement unified bioinformatic and statistical analysis workflows.

  • Collaborative research agreements:

    • Material transfer protocols: Establish clear procedures for strain and plasmid sharing.

    • Publication authorship guidelines: Define authorship criteria and contribution acknowledgment in advance.

    • Intellectual property frameworks: Agree on IP ownership and potential commercialization pathways.

  • Funding strategies:

    • Multi-PI grant applications: Pursue funding mechanisms specifically designed for collaborative research.

    • International partnership development: Explore funding opportunities across different countries.

    • Industry-academic collaborations: Consider partnerships with biotechnology companies interested in transporter engineering.

  • Knowledge dissemination plans:

    • Integrated publication strategy: Coordinate manuscript preparation to tell a coherent scientific story.

    • Pre-publication data sharing: Consider depositing data in appropriate repositories before publication.

    • Community engagement: Present at conferences focusing on B. subtilis biology and transport mechanisms.

This structured collaborative approach maximizes research efficiency while enabling comprehensive investigation of YfiN's complex biological functions.

What are the key considerations for designing a comprehensive research program to characterize YfiN function in B. subtilis?

A comprehensive YfiN research program should address these key elements:

  • Program structure and timeline:

    • Phase I (1-2 years): Basic characterization of YfiN expression, localization, and preliminary functional analysis.

    • Phase II (2-3 years): Detailed biochemical, structural, and physiological characterization.

    • Phase III (3-5 years): Systems-level integration and applied research directions.

  • Methodological diversity:

    • Multi-technique integration: Combine genetic, biochemical, structural, and computational approaches.

    • Scale considerations: Link molecular-level mechanisms to cellular and population-level phenotypes.

    • Technology development: Include development of new tools specific for membrane protein analysis.

  • Resource requirements:

    Resource CategoryCore RequirementsAdvanced Requirements
    PersonnelMolecular biologists, BiochemistsStructural biologists, Bioinformaticians
    EquipmentPCR, Cell culture, Basic protein purificationMass spectrometry, Cryo-EM, Supercomputing
    MaterialsB. subtilis strains, Expression vectorsSpecialized lipids, Isotope-labeled media
    SoftwareBasic analysis tools, SubtiList database Molecular dynamics, Machine learning
  • Risk assessment and mitigation:

    • Technical challenges: Develop alternative approaches for high-risk experiments.

    • Contingency planning: Identify decision points for redirecting efforts if certain approaches fail.

    • Resource allocation strategy: Balance investments between high-risk/high-reward and safer approaches.

  • Training and knowledge transfer:

    • Skill development program: Train researchers in specialized techniques for membrane protein analysis.

    • Cross-disciplinary education: Ensure team members understand approaches outside their specialty.

    • Knowledge preservation: Implement comprehensive documentation of protocols and results.

  • Evaluation metrics:

    • Publication benchmarks: Define expected publication outcomes at each research phase.

    • Technology development goals: Establish metrics for new methodologies and tools.

    • Application milestones: Set targets for applying YfiN knowledge to biotechnological challenges.

This comprehensive program structure provides a roadmap for systematic investigation of YfiN, balancing fundamental characterization with potential applications while ensuring efficient resource utilization.

Based on current knowledge, what are the most promising future research directions for understanding YfiN function?

The study of YfiN in B. subtilis presents several compelling research frontiers:

  • Integrated structural and functional analysis:

    • Pursue high-resolution structural determination through cryo-EM or X-ray crystallography.

    • Correlate structural features with transport mechanism through targeted mutagenesis.

    • Apply advanced biophysical techniques to capture transport-associated conformational changes in real-time.

  • Systems biology integration:

    • Map YfiN's position in the broader cellular transport network.

    • Identify metabolic pathways dependent on YfiN function.

    • Model the impact of YfiN activity on cellular homeostasis using genome-scale metabolic models.

  • Environmental adaptation role:

    • Investigate YfiN's contribution to B. subtilis survival under changing environmental conditions.

    • Determine its role in transitions between vegetative growth and sporulation .

    • Assess function during biofilm formation and other community behaviors.

  • Comparative transport biology:

    • Extend studies to YfiN homologs across the Bacillus genus and beyond.

    • Correlate sequence variations with functional differences and ecological adaptations.

    • Explore co-evolution with substrate-producing or substrate-consuming organisms in natural habitats.

  • Biotechnological applications:

    • Engineer YfiN for enhanced or altered substrate specificity.

    • Explore applications in recombinant protein production, taking advantage of B. subtilis' favorable characteristics .

    • Develop YfiN-based biosensors or transport systems for biotechnological processes.

  • Therapeutic relevance exploration:

    • Investigate homologs in pathogenic bacteria as potential drug targets.

    • Explore applications in vaccine development, building on B. subtilis spore display technology .

    • Assess potential for engineered probiotics based on modified B. subtilis strains.

These research directions leverage B. subtilis' advantages as a model organism while opening avenues for both fundamental discoveries and practical applications.

What emerging technologies and methodologies might accelerate research on YfiN and related membrane transporters?

Cutting-edge approaches poised to transform YfiN research include:

  • Advanced structural biology techniques:

    • Cryo-electron tomography: Visualize YfiN in its native membrane environment at near-atomic resolution.

    • Micro-electron diffraction (MicroED): Determine structures from microcrystals unsuitable for traditional crystallography.

    • Integrative structural biology platforms: Combine multiple experimental data types with computational modeling.

  • Single-molecule approaches:

    • Single-molecule FRET: Track conformational changes during individual transport cycles.

    • High-speed atomic force microscopy: Observe structural dynamics in membrane environment.

    • Nanopore-based electrophysiology: Measure transport events of single YfiN molecules.

  • Genome engineering advances:

    • CRISPR interference (CRISPRi): Fine-tune YfiN expression levels without complete gene deletion.

    • Base editing technologies: Create precise point mutations without double-strand breaks.

    • Multiplex genome engineering: Simultaneously modify YfiN and related transporters to address functional redundancy.

  • Artificial intelligence applications:

    • Deep learning for structure prediction: Apply AlphaFold2 and similar tools to predict YfiN structure and dynamics.

    • Machine learning for functional prediction: Develop models to predict substrates from sequence features.

    • Automated experimental design: Use AI to optimize experimental parameters and suggest critical experiments.

  • Advanced imaging technologies:

    • Super-resolution microscopy: Track YfiN localization and dynamics in living cells.

    • Mass spectrometry imaging: Visualize metabolite distributions related to YfiN function.

    • Correlative light and electron microscopy: Connect functional dynamics with ultrastructural context.

  • Microfluidics and high-throughput approaches:

    • Droplet microfluidics: Screen thousands of YfiN variants for altered function.

    • Microfluidic device integration: Study transport under precisely controlled environmental gradients.

    • Single-cell omic technologies: Correlate YfiN expression with cellular phenotypes at single-cell resolution.

These emerging technologies promise to overcome current technical barriers, accelerating our understanding of YfiN and opening new avenues for its application in biotechnology and medicine.

How might research on YfiN contribute to broader understanding of membrane transport mechanisms and bacterial adaptation?

YfiN research has far-reaching implications for fundamental microbiology and applied sciences:

  • Transport mechanism paradigms:

    • Elucidate general principles of bacterial membrane transport applicable across species.

    • Identify novel regulatory mechanisms coordinating transport with cellular metabolism.

    • Reveal evolutionary adaptations in transport systems responding to environmental niches.

  • Bacterial stress response understanding:

    • Clarify how transport systems contribute to environmental adaptation strategies.

    • Illuminate connections between nutrient acquisition and stress tolerance.

    • Enhance models of bacterial persistence under challenging conditions.

  • Host-microbe interaction insights:

    • Understand roles of transporters in bacterial colonization of hosts.

    • Leverage B. subtilis as a safe model for studying mechanisms relevant to pathogens.

    • Apply findings to probiotic development and optimization, given B. subtilis' GRAS status .

  • Synthetic biology applications:

    • Design programmable transport systems with defined substrate specificities.

    • Develop transport-based cellular circuits responding to environmental signals.

    • Create modular transport components for synthetic cell construction.

  • Antimicrobial development strategies:

    • Identify novel transporter-based targets for antimicrobial development.

    • Understand mechanisms of antimicrobial uptake and efflux.

    • Leverage B. subtilis' production of antimicrobial compounds in conjunction with engineered transport systems.

  • Industrial biotechnology advancement:

    • Optimize nutrient uptake for enhanced production of valuable compounds.

    • Improve protein secretion for industrial enzyme production, building on B. subtilis' established role in enzyme manufacturing .

    • Engineer transport systems for bioprocessing applications in harsh industrial conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.