Recombinant Bacillus subtilis Putative undecaprenyl-phosphate N-acetylgalactosaminyl 1-phosphate transferase (tuaA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Putative Undecaprenyl-Phosphate N-Acetylgalactosaminyl 1-Phosphate Transferase (TuaA)

Bacillus subtilis is a Gram-positive bacterium well-regarded as a microbial cell factory for producing recombinant proteins with applications in various industries . Recombinant proteins are produced through a multistep process that involves gene isolation, DNA cloning, transformation, selection, protein expression, purification, quality control, and scale-up production .

TuaA, or Undecaprenyl-phosphate N-acetylgalactosaminyl 1-phosphate transferase, is an enzyme involved in synthesizing cell wall teichoic acids (WTAs) . WTAs are anionic polymers with roles in bacterial cell shape, cell division, envelope integrity, biofilm formation, and pathogenesis . In Bacillus subtilis, TuaA is involved in the initial steps of WTA biosynthesis . Specifically, a library of single null mutants was created by replacing the tuaA gene with an antibiotic resistance gene .

Function and Importance of TuaA

TuaA is an essential enzyme for producing cell surface structures in Bacillus subtilis . Enzymes exhibit enhanced efficiency, leading to more streamlined and productive industrial processes, resulting in higher quality and purity of end products as their specificity is improved to target the substrates . Moreover, the enzymes demonstrate superior stability, allowing for longer and more reliable usage in industrial settings .

Recombinant Production and Applications

Recombinant Bacillus subtilis strains are engineered to enhance the production of specific proteins or enzymes, like TuaA, for industrial or therapeutic purposes . Recombinant proteins have a wide range of applications in biomedical research, revolutionizing drug discovery and development, diagnostics, and immunotherapy .

Impact on Bacterial Fitness and Enzyme Yield

The production of recombinant proteins in Bacillus subtilis can induce secretion stress, potentially affecting cell viability and product yield . The CssR-CssS two-component system and CssRS-regulated quality control proteases HtrA and HtrB play critical roles in the secretion stress response . Specifically, proteolytically inactive HtrA enhances bacterial fitness and recombinant enzyme production, especially upon scale-up .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. To ensure a specific tag, please inform us beforehand, and we will prioritize its development.
Synonyms
tuaA; yvhA; BSU35610; Putative undecaprenyl-phosphate N-acetylgalactosaminyl 1-phosphate transferase; Teichuronic acid biosynthesis protein TuaA; UDP-GalNAc:undecaprenyl-P GalNAc-1-P transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
tuaA
Target Protein Sequence
MSAEKSMNVSREFSVQQIHSFTLSEKTARYLAIKRVMDIWFALIGLAIALPMIAVFSILI CLETPGPAIYTQERVGKGGKPFKLYKLRSMKIDAEKSGAVWAQKQDPRVTRIGAFIRRTR IDELPQLFNVLKGDMSMIGPRPERPVFTEKFQNEIPGFTQRLGSGERRLRYDAEGKADI
Uniprot No.

Target Background

Function
This protein may mediate the initial reaction in teichuronic acid synthesis: the formation of lipid-linked N-acetylglucosamine.
Database Links
Protein Families
Bacterial sugar transferase family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is tuaA and what is its function in Bacillus subtilis?

TuaA is a putative undecaprenyl-phosphate N-acetylgalactosaminyl 1-phosphate transferase encoded by the tuaA gene in Bacillus subtilis. It functions as a glucosyl transferase involved in the biosynthesis of teichuronic acid, a component of the bacterial cell wall . TuaA shows homology to other glycosyltransferases like WcaJ of E. coli, which encodes a UDP-glucose lipid carrier . With a calculated molecular mass of approximately 20.2 kDa, tuaA plays a crucial role in cell envelope synthesis and modification.

Methodological approach to studying tuaA function:

  • Conduct gene deletion experiments to observe phenotypic changes

  • Perform complementation assays with recombinant tuaA

  • Analyze cell wall composition in wild-type vs. tuaA-deficient strains

  • Use radiolabeled substrates to track transferase activity

Where is the tuaA gene located in the B. subtilis genome?

The tuaA gene is located immediately downstream of the lytC gene in the B. subtilis genome. It is part of the tua operon, which consists of eight genes (tuaA-H) spanning approximately 9.0 kb . The tuaA gene uses the relatively unusual GUG start codon and is preceded by a putative ribosome-binding site (RBS) with a ΔG value of -13.8 kcal . A stem-loop structure resembling an intrinsic transcription termination element is located between lytC and tuaA .

How is tuaA expression regulated in B. subtilis?

TuaA expression is primarily regulated as part of the tua operon. Research indicates that the tua operon is under the control of the PhoR-PhoP two-component regulatory system, which responds to phosphate limitation . Under phosphate-limited conditions, expression of the tua operon increases, leading to enhanced teichuronic acid production. This regulation mechanism allows B. subtilis to adapt its cell wall composition based on environmental phosphate availability.

Experimental approach to study tuaA regulation:

  • Utilize Northern blot analysis with DIG-labeled RNA probes specific to tuaA

  • Grow cultures in low phosphate (LPDM) and high phosphate (HPDM) defined media

  • Extract total RNA approximately 300 minutes after transition to stationary phase

  • Analyze transcript levels to determine phosphate-dependent regulation

What experimental systems are available for studying recombinant tuaA?

Several experimental systems can be used to study recombinant tuaA:

  • Expression vectors: Plasmid-based expression systems with inducible promoters like the subtilin-inducible promoter system

  • Heterologous expression: Expression in E. coli for protein purification and biochemical characterization

  • Gene deletion and complementation: Creating tuaA knockout strains and complementing with recombinant tuaA to confirm function

  • Reporter gene fusions: Construction of tuaA-lacZ fusions to study promoter activity and regulation

How does the mechanism of tuaA transferase activity compare with similar enzymes in other bacterial species?

TuaA is part of a larger family of glycosyltransferases that catalyze the transfer of sugar moieties to lipid carriers. Comparative analysis with similar enzymes provides insights into its catalytic mechanism:

EnzymeOrganismSubstrateProductSimilarity to tuaA
TuaAB. subtilisUDP-GalNAc, Und-PUnd-P-GalNAcReference
WcaJE. coliUDP-Glc, Und-PUnd-P-GlcHomologous glucosyltransferase
FlmF2F. novicidaUDP-GalNAc, Und-PUnd-P-GalNAcSimilar substrate specificity
FlmF1F. novicidaUDP-Glc, Und-PUnd-P-GlcRelated but different sugar specificity
ArnCE. coliUDP-L-Ara4FN, Und-PUnd-P-L-Ara4FNRelated but different sugar specificity

FlmF2 in Francisella novicida shows particularly interesting mechanistic similarities, as it "selectively catalyzes the condensation of undecaprenyl phosphate and UDP-N-acetylgalactosamine to generate undecaprenyl phosphate-N-acetylgalactosamine" . This suggests conserved catalytic mechanisms across bacterial species for similar transferase reactions. In experimental systems, researchers have demonstrated that recombinant FlmF2 expressed in E. coli can perform this condensation reaction in vitro .

What are the challenges in purifying active recombinant tuaA and how can they be overcome?

Purification of active recombinant tuaA presents several challenges:

  • Membrane association: As a transferase involved in cell envelope synthesis, tuaA likely associates with membranes, making solubilization difficult.

  • Substrate availability: The enzyme requires specialized substrates like undecaprenyl phosphate and UDP-N-acetylgalactosamine.

  • Activity assays: Developing reliable assays to confirm enzymatic activity of the purified protein.

Methodological solutions:

  • Optimized expression systems: Consider using specialized expression strains like B. subtilis itself, which may better handle membrane proteins than E. coli.

  • Detergent screening: Systematic testing of different detergents for optimal solubilization while maintaining activity.

  • Mass spectrometry-based assays: As described for FlmF2, LC-ESI/MS can be used to detect the formation of undecaprenyl phosphate-GalNAc . Reaction conditions might include:

    • 0.5 mg/mL membranes containing recombinant tuaA

    • 4 μM undecaprenyl phosphate

    • 4 μM UDP-GalNAc

    • 2 mM MnCl₂

    • 150 mM KCl

    • 0.5 mg/mL phospholipids

    • 1.0 mg/mL BSA

    • 0.1% Triton X-100

    • 50 mM HEPES, pH 7.5

  • Fusion tags: Strategic use of solubility-enhancing tags that can be removed post-purification.

How does deletion of tuaA affect protein secretion in B. subtilis, and what are the mechanisms involved?

Deletion of the tuaA gene has been found to impact protein secretion in B. subtilis. Research indicates that tuaA deletion can enhance the secretion of certain heterologous proteins:

  • Observed effects: Studies have shown that inactivation of cell surface components, including tuaA, helps increase the secretion of proteins such as α-amylases . This suggests that tuaA-encoded structures may constitute part of the secretion barrier in the cell envelope.

  • Mechanism: The putative mechanism involves weakening of the cell envelope barrier by removing teichuronic acid components that might otherwise impede protein translocation across the cell wall.

  • Experimental data: In experiments with α-amylase secretion, tuaA-deficient strains showed increased extracellular release of the enzyme compared to wild-type strains .

  • Combined engineering approaches: For optimal results, researchers have found that combining tuaA deletion with modifications to other cell surface components (like tagO, dltA, dacA) can have synergistic effects on protein secretion .

Methodological approach for studying secretion effects:

  • Create precise gene deletions using antibiotic resistance markers

  • Express reporter proteins like amylases under controlled conditions

  • Quantify extracellular vs. cell-associated protein levels

  • Analyze cell wall composition changes in the mutant strains

What techniques can be used to investigate the interaction between tuaA and other components of the teichuronic acid synthesis pathway?

Several advanced techniques can be employed to study the interactions of tuaA within the teichuronic acid synthesis pathway:

  • Bacterial two-hybrid systems: Adapted for membrane proteins to detect direct protein-protein interactions between tuaA and other tua operon products.

  • Co-immunoprecipitation: Using epitope-tagged versions of tuaA to pull down interacting partners and identify them by mass spectrometry.

  • Blue native PAGE: To isolate and characterize native protein complexes containing tuaA.

  • FRET-based approaches: Fusing fluorescent proteins to tuaA and potential partners to detect interactions in vivo.

  • Crosslinking mass spectrometry: To identify interaction interfaces between tuaA and other proteins.

  • Lipidomic analysis: To characterize the lipid substrates and products in wild-type vs. tuaA mutant strains.

How can advanced promoter engineering improve the expression of recombinant tuaA in B. subtilis?

Optimizing expression of recombinant tuaA can be achieved through strategic promoter engineering approaches:

  • Transcriptome mining: Researchers have identified several highly active promoters in B. subtilis from transcriptome data, including Phag, PtufA, PsodA, and PfusA, which have shown significantly higher expression levels compared to the traditional PamyE promoter .

  • Multi-promoter constructs: Combining multiple strong promoters has demonstrated synergistic effects. For example, a triple-promoter construct combining PsodA+fusA+amyE showed 4.73 times higher activity than the single PamyE promoter in shake flask experiments .

  • Scale-up potential: In fermenter conditions, optimized promoter systems can achieve even greater improvements, with the PsodA+fusA+amyE construct showing 21.9 times higher activity than flask-grown PamyE strain .

Recommended methodological approach:

  • Screen and select multiple strong promoters from transcriptome data

  • Create single, dual, and triple promoter constructs

  • Include the STAB-SD mRNA stabilizing sequence from Bacillus thuringiensis cry3A to improve mRNA stability

  • Test expression levels in both shake flask and fermenter conditions

  • Verify protein functionality through appropriate activity assays

How can tuaA be utilized in biofilm research with B. subtilis?

B. subtilis serves as a model organism for biofilm research, producing a protective extracellular matrix . The role of tuaA in cell wall synthesis makes it relevant for biofilm studies in several ways:

  • Cell surface properties: As tuaA affects teichuronic acid synthesis, it may influence cell surface hydrophobicity and charge, which are critical for initial attachment during biofilm formation.

  • Matrix interactions: Research on B. subtilis biofilms has revealed that matrix proteins like BslA and TasA are interfacially active and contribute to biofilm architecture . Investigating potential interactions between tuaA-modified cell surfaces and these matrix proteins could provide insights into biofilm assembly.

  • Environmental adaptation: Since tuaA expression is regulated by phosphate availability, studying how phosphate limitation affects biofilm formation through changes in cell wall composition could reveal adaptive strategies.

Experimental approach:

  • Generate tuaA deletion mutants and examine their biofilm formation capacity

  • Use fluorescence microscopy with matrix protein reporters to visualize biofilm architecture

  • Perform interface assays to determine how teichuronic acid affects the assembly of the biofilm matrix

  • Compare wild-type and tuaA mutant biofilms under varying phosphate concentrations

What strategies can improve the structural characterization of tuaA protein?

Structural characterization of membrane-associated proteins like tuaA presents unique challenges. Several strategies can be employed:

  • Protein engineering: Create soluble domains or fusion constructs that maintain catalytic activity but are easier to purify and crystallize.

  • Advanced crystallography approaches:

    • Lipidic cubic phase crystallization for membrane proteins

    • Microcrystal electron diffraction (MicroED) for small crystals

    • Serial femtosecond crystallography using X-ray free-electron lasers

  • Cryo-electron microscopy: Single-particle analysis or tomography of tuaA in native-like membrane environments.

  • NMR spectroscopy: Solution NMR of detergent-solubilized protein or solid-state NMR of membrane-embedded tuaA.

  • Computational approaches: Homology modeling based on related transferases with known structures, followed by molecular dynamics simulations to predict conformational states.

  • Hydrogen-deuterium exchange mass spectrometry: To map the topology and identify substrate-binding regions.

What are the most effective methods for analyzing the enzymatic activity of recombinant tuaA in vitro?

To analyze the enzymatic activity of recombinant tuaA effectively, consider the following approaches:

  • Direct activity assays:

    • Radiolabeled substrate incorporation assays measuring the transfer of labeled sugars to lipid carriers

    • HPLC or TLC-based separation of reaction products

    • Mass spectrometry detection of undecaprenyl phosphate-GalNAc formation

  • Coupled enzyme assays:

    • Detection of UDP release using auxiliary enzymes (similar to kinase assays)

    • Colorimetric or fluorometric readouts for high-throughput screening

  • Optimal reaction conditions:
    Similar to conditions reported for related enzymes like FlmF2 :

    • Buffer: 50 mM HEPES, pH 7.5

    • Ionic conditions: 2 mM MnCl₂, 150 mM KCl

    • Detergent: 0.1% Triton X-100

    • Stabilizers: 0.5 mg/mL phospholipids, 1.0 mg/mL BSA

    • Substrates: undecaprenyl phosphate and UDP-N-acetylgalactosamine

  • Product verification:

    • LC-ESI/MS analysis using a two-phase Bligh-Dyer system extraction

    • Analysis of lower phase by mass spectrometry

How might CRISPR-Cas9 techniques be optimized for studying tuaA function in B. subtilis?

CRISPR-Cas9 offers powerful opportunities for precise genetic manipulation of tuaA in B. subtilis:

  • Precise gene editing: Design guide RNAs targeting specific regions of tuaA to create point mutations that affect enzyme activity without completely eliminating the protein.

  • Conditional knockdowns: Implement CRISPRi (CRISPR interference) systems with dCas9 to create tunable repression of tuaA expression, allowing for temporal control of the teichuronic acid synthesis pathway.

  • Domain mapping: Create a library of precise deletions within the tuaA coding sequence to map functional domains and critical residues.

  • Multiplex editing: Simultaneously target multiple genes in the tua operon to understand pathway interactions.

  • Base editing: Use CRISPR base editors to introduce specific codon changes without creating double-strand breaks, which can be challenging to repair in B. subtilis.

Methodological considerations:

  • Optimize guide RNA design for the AT-rich genome of B. subtilis

  • Use non-homologous end joining (NHEJ)-deficient strains to favor homology-directed repair

  • Implement transient CRISPR-Cas9 expression to minimize off-target effects

  • Verify edits through whole-genome sequencing to detect potential off-target modifications

What is the potential role of tuaA in bacterial adaptation to environmental stresses beyond phosphate limitation?

While tuaA expression is known to be regulated by phosphate availability through the PhoR-PhoP system, its potential roles in other stress responses warrant investigation:

  • Cell wall integrity stress: As a component of teichuronic acid synthesis, tuaA may be involved in maintaining cell wall integrity under various stresses like osmotic shock, antimicrobial challenges, or pH fluctuations.

  • Host-microbe interactions: For plant-associated B. subtilis strains, tuaA-mediated cell wall modifications might influence colonization efficiency and plant growth promotion properties .

  • Biofilm-specific regulation: Expression patterns of tuaA during the transition from planktonic to biofilm growth could reveal specialized functions in communal lifestyles.

  • Spore formation: Potential roles in modifying the spore cortex during sporulation, a key survival strategy of B. subtilis .

Research approach:

  • Perform transcriptomic analysis of tuaA expression under various stress conditions

  • Create reporter strains with fluorescent proteins fused to the tuaA promoter

  • Assess competitive fitness of wild-type vs. tuaA mutants under different environmental challenges

  • Examine tuaA expression throughout the biofilm development cycle and during sporulation

How can systems biology approaches advance our understanding of tuaA's role in cellular metabolism?

Systems biology offers comprehensive frameworks to understand tuaA in the context of cellular metabolism:

  • Metabolic flux analysis: Trace the flow of carbon and nitrogen through pathways connected to teichuronic acid synthesis using isotope labeling and mass spectrometry.

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data to create comprehensive models of how tuaA expression affects global cellular processes.

  • Genome-scale metabolic modeling: Incorporate tuaA-mediated reactions into genome-scale metabolic models of B. subtilis to predict systemic effects of pathway modulation.

  • Synthetic biology applications: Design synthetic circuits that control tuaA expression in response to specific environmental cues, potentially creating strains with enhanced secretion capabilities for biotechnology applications.

  • Evolutionary analysis: Compare tuaA homologs across the Bacillus genus to understand evolutionary pressures and functional conservation of this transferase.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.