Recombinant Bacillus subtilis Quinol oxidase subunit 3 (qoxC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant qoxC

Recombinant qoxC is produced by cloning and expressing the qoxC gene (encoding subunit III of cytochrome aa₃-600) in heterologous systems such as E. coli or yeast. The protein is often fused with affinity tags (e.g., His-tag) to facilitate purification . Subunit III is essential for the proper assembly of the aa₃-600 oxidase complex, as its deletion disrupts heme incorporation and enzyme stability .

Functional Role in the Oxidase Complex

  • Assembly: Deletion of qoxC disrupts heme aa₃-600 incorporation, leading to a nonfunctional oxidase .

  • Proton Pumping: While subunit IV (qoxD) is directly involved in proton translocation, qoxC’s structural integrity is necessary for maintaining the enzyme’s quaternary structure .

  • Respiratory Chain Contribution: The aa₃-600 oxidase is the dominant terminal oxidase during exponential growth, contributing to the proton motive force and sporulation efficiency .

Production and Purification

Recombinant qoxC is produced in multiple expression systems with the following specifications:

ParameterDetail
Host SystemsE. coli, yeast, baculovirus, or mammalian cells
Purity≥85% (SDS-PAGE)
StorageLyophilized at -20°C/-80°C; reconstituted in Tris/PBS buffer with trehalose

The protein retains functionality in structural studies and inhibitor-binding assays .

Key Research Findings

  1. Gene Deletion Studies:

    • Strains lacking qoxC show no detectable heme aa₃-600, confirming its role in oxidase assembly .

    • The aa₃-600 oxidase is nonessential for growth, but its absence reduces sporulation efficiency .

  2. Structural Insights:

    • Crystallographic studies at 3.6 Å resolution highlight qoxC’s role in stabilizing the menaquinol-binding cleft formed by TM0, TM1, and TM2 of subunit I .

    • Inhibitors like HQNO bind near residues R70 and D74 of subunit I, indirectly influenced by qoxC’s structural positioning .

  3. Evolutionary Conservation:

    • Subunit III’s TMHs overlap with helices in canonical cytochrome c oxidases, suggesting evolutionary divergence in quinol oxidase architecture .

Applications and Relevance

  • Antimicrobial Target: The aa₃-600 oxidase is a potential target for B. subtilis-specific inhibitors due to its role in energy metabolism .

  • Biochemical Tool: Recombinant qoxC enables structural and functional studies of bacterial respiratory complexes .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly specify them when placing your order. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. We kindly request you to consult your local distributors for precise delivery timelines.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend a brief centrifugation of the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know and we will prioritize the development of that specific tag.
Synonyms
qoxC; BSU38150; ipa-39d; Quinol oxidase subunit 3; Oxidase aa(3-600 subunit 3; Quinol oxidase aa3-600, subunit QoxC; Quinol oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
qoxC
Target Protein Sequence
MEHAEHGNSNAPMEYQSETGRLNILGFWIFLGAEIVLFSTLFATFFVLKNRTAGGVLPDE LFEVNLVMIMTFLLLISSFTCGIAVHEMRRGSLKGVVIWTIITLLLGAGFVGCEINEFVH YVHEGAALSTSAFWSGFFVLLGTHGTHVTIGIFWITGILIQLKKRGLTPQTSSKIFISSL YWHFLDVVWIFIFTGVYLMGLGGL
Uniprot No.

Target Background

Function
Quinol oxidase subunit 3 (qoxC) catalyzes the oxidation of quinol, with the simultaneous reduction of oxygen to water. It is a major component in the energy conversion process during vegetative growth in *Bacillus subtilis*.
Database Links
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of qoxC in Bacillus subtilis?

The qoxC gene encodes subunit III of the proton-pumping aa3-600 quinol oxidase in Bacillus subtilis. It is part of the qox operon that contains four genes (qoxA, qoxB, qoxC, and qoxD) coding for the four subunits of this oxidase complex . Research has demonstrated that qoxC plays a critical role in the proper assembly of the aa3-600 quinol oxidase. When the qoxC gene is deleted, it results in defective assembly of the oxidase complex, indicating its essential structural role . This contrasts with deletion of qoxD (subunit IV), which still allows normal assembly but reduces respiratory activity and proton pumping efficiency.

What happens when qoxC is deleted from B. subtilis?

Deletion of the qoxC gene results in defective assembly of the aa3-600 quinol oxidase complex . Using homologous gene recombination techniques in B. subtilis, researchers have demonstrated that strains with qoxC deletion show impaired oxidase assembly. This suggests that subunit III, encoded by qoxC, is crucial for the structural integrity and proper formation of the functional oxidase complex. The defective assembly consequently impacts the respiratory capacity of B. subtilis and its ability to generate proton gradients effectively.

How does qoxC function differ from qoxD in the oxidase complex?

While both genes are part of the same qox operon, they serve distinct functions in the aa3-600 quinol oxidase complex:

FeatureqoxC (Subunit III)qoxD (Subunit IV)
FunctionCritical for assembly of the oxidase complexImportant for full respiratory activity and proton pumping
Effect of deletionDefective assembly of the aa3-600 quinol oxidaseNormal heme aa3-600 content but reduced respiratory and proton pumping activity
Structural roleEssential for proper complex formationEnhances efficiency but not essential for assembly

This functional differentiation demonstrates the specialized roles of each subunit in the quaternary structure of the oxidase complex . While subunit III (qoxC) appears primarily important for structural assembly, subunit IV (qoxD) is more directly involved in optimizing the functional activity of the complex once assembled.

What methodologies are most effective for recombinant expression of qoxC in B. subtilis expression systems?

For recombinant expression of qoxC in B. subtilis, several methodologies have proven effective, with selection depending on research objectives. When using B. subtilis as an expression platform, researchers can employ the following approaches:

  • Chromosomal integration: Using vectors like pDG1664 that allow ectopic insertion of cloned genes at specific loci (e.g., thrC) through double-crossover recombination events . This approach provides stable gene expression without the need for continual antibiotic selection.

  • Promoter selection: The rrnO promoter system has been successfully used for high-level vegetative expression in B. subtilis . For qoxC expression, this promoter can drive strong expression during vegetative growth.

  • Expression optimization: Incorporating an optimized ribosome binding site (RBS) such as the sspA RBS has shown improved translation efficiency . For qoxC expression, codon optimization based on B. subtilis preferences may further enhance yield.

Importantly, verification of successful expression should include Western blotting using appropriate antibodies and functional assays to confirm that the recombinant qoxC is properly incorporated into the oxidase complex.

How can researchers effectively measure the assembly and function of the oxidase complex following qoxC manipulation?

Researchers studying qoxC functionality and its role in oxidase complex assembly can employ several complementary techniques:

  • Spectroscopic analysis: Measurement of heme aa3-600 content by spectroscopic methods provides direct evidence of oxidase complex assembly status . In strains with qoxC deletion, diminished spectral signatures indicate defective assembly.

  • Respiratory activity assays: Quantifying oxygen consumption rates in whole cells or membrane preparations using oxygen electrodes can assess the functional consequences of qoxC manipulation . Comparative analysis between wild-type and qoxC-modified strains reveals the impact on respiratory capacity.

  • Proton pumping measurements: Assessing the proton gradient formation using pH-sensitive fluorescent dyes or direct pH measurements can determine how qoxC modifications affect the proton-pumping ability of the oxidase complex .

  • Protein complex analysis: Blue native polyacrylamide gel electrophoresis (BN-PAGE) followed by Western blotting can visualize the intact complex and determine whether qoxC modifications affect complex formation or stability.

These methodologies provide complementary data about both structural assembly and functional consequences of qoxC manipulations.

What are the challenges in distinguishing between assembly defects and functional defects when studying qoxC mutations?

Distinguishing between assembly defects and functional defects presents a significant challenge in qoxC research due to several factors:

The primary challenge is that assembly and function are interconnected—improper assembly naturally leads to functional deficits, making it difficult to isolate pure functional effects. Researchers must employ a systematic approach combining multiple analytical techniques to differentiate these phenomena.

Structural biology approaches, including cryo-electron microscopy or crystallography of the oxidase complex from wild-type and mutant strains, can provide direct visual evidence of assembly differences. These techniques require significant expertise but offer unparalleled insight into structural consequences of qoxC manipulation.

Complementation studies with various qoxC constructs can help map specific domains responsible for assembly versus function. By reintroducing modified qoxC genes with targeted mutations into deletion strains, researchers can identify which regions are critical for complex assembly versus catalytic function.

Finally, time-course studies of complex formation can reveal whether qoxC mutations affect the rate of assembly or the stability of the formed complex, providing temporal discrimination between assembly and functional defects.

What gene recombination strategies are most effective for studying qoxC function?

For studying qoxC function, several gene recombination strategies have proven particularly effective:

Complete gene deletion: The most straightforward approach involves deleting the entire qox operon and then complementing with modified versions where specific genes (like qoxC) are deleted or altered . This strategy, leveraging B. subtilis' high efficiency of homologous recombination, provides clean genetic backgrounds for functional studies.

Domain swapping: Replacing portions of qoxC with corresponding regions from related organisms can identify evolutionarily conserved functional domains and organism-specific adaptations.

Regulated expression systems: Implementing inducible promoters to control qoxC expression levels allows researchers to determine dose-dependent effects and threshold levels required for proper assembly and function.

The choice of recombination strategy should align with specific research questions. For basic functional characterization, complete deletion followed by complementation provides the clearest results. For mechanistic insights, point mutations or domain swaps offer more nuanced information about specific protein regions.

How does the choice of expression system impact qoxC functionality in recombinant B. subtilis?

The expression system selection significantly impacts qoxC functionality in recombinant B. subtilis, with several factors requiring careful consideration:

Expression System FeatureImpact on qoxC FunctionalityMethodological Considerations
Promoter strengthStrong promoters may lead to overexpression and improper stoichiometry with other qox subunitsSelect balanced expression systems that maintain natural stoichiometric ratios
Expression timingConstitutive vs. inducible expression affects assembly with partner subunitsCoordinate expression timing with other operon components
Integration locationChromosomal position effects can alter expression levelsUse well-characterized neutral loci like amyE or thrC for consistent expression
Tag additionFusion tags can interfere with assembly of the membrane-bound complexConsider tag-free systems or removable tags for functional studies

Research has demonstrated that for membrane protein complexes like quinol oxidase, maintaining proper stoichiometry between subunits is critical for correct assembly and function . Expression systems that dramatically alter the natural ratios between qoxA, qoxB, qoxC, and qoxD may result in artificial phenotypes that don't accurately reflect native function.

What analytical techniques provide the most comprehensive assessment of qoxC-dependent oxidase assembly?

A comprehensive assessment of qoxC-dependent oxidase assembly requires the integration of multiple analytical techniques:

  • Spectroscopic analysis: Absorption spectroscopy targeting the characteristic peaks of heme aa3-600 provides direct evidence of complex assembly . This technique reveals whether the deletion or modification of qoxC affects the incorporation of prosthetic groups essential for oxidase function.

  • Protein quantification: Western blotting with antibodies specific to each subunit can determine whether qoxC modification affects the stability of other subunits. Quantitative analysis of band intensities reveals stoichiometric relationships between components.

  • Membrane fraction analysis: Proper fractionation of bacterial membranes followed by activity assays can determine whether the assembled complex correctly localizes to the membrane and maintains its enzymatic capacity.

  • Electron microscopy: Negative staining or cryo-EM of membrane preparations can visualize the intact oxidase complex and assess structural integrity following qoxC manipulation.

  • Native gel electrophoresis: Blue native PAGE separates intact membrane protein complexes and can determine whether qoxC modification affects the formation of the complete oxidase complex.

The most robust approach combines these techniques to provide complementary lines of evidence. For example, normal spectroscopic signals but abnormal native gel migration would suggest a structurally altered but partially assembled complex.

How can researchers resolve contradictory data regarding qoxC function in different experimental settings?

When faced with contradictory data regarding qoxC function, researchers should implement a systematic troubleshooting approach:

First, evaluate experimental conditions across studies, as differences in growth phase, media composition, or oxygen availability can significantly impact respiratory complex expression and activity . Standardizing these conditions allows for more reliable comparisons between experiments.

Finally, perform complementation studies with the wild-type gene to confirm that observed phenotypes are directly attributable to qoxC modification rather than polar effects or secondary mutations. This genetic validation is essential for establishing causality.

What controls and standards are essential when studying recombinant qoxC expression in B. subtilis?

When studying recombinant qoxC expression in B. subtilis, the following controls and standards are essential for reliable data interpretation:

  • Parental strain controls: Always include the unmodified parental strain (e.g., PY79 or 168-type strains) as a baseline control for all experiments . This establishes normal oxidase assembly and activity levels for comparison.

  • Complete deletion controls: Include a strain with complete deletion of the qox operon to establish the baseline phenotype of cells lacking the oxidase complex entirely . This control helps distinguish partial from complete loss of function.

  • Single-gene complementation: When studying qoxC function, include controls where only qoxC is reintroduced into a deletion background to confirm specific effects.

  • Expression level verification: Implement quantitative measures of gene expression (qPCR) and protein production (Western blotting) to ensure comparable expression levels between experimental strains.

  • Functional standards: Include standardized activity assays that measure respiratory capacity and proton pumping to enable cross-laboratory comparisons.

  • Environmental controls: Maintain strict control of growth conditions, including temperature, aeration, and media composition, as these significantly impact respiratory complex formation and activity.

Proper implementation of these controls enables researchers to distinguish specific qoxC-related phenotypes from general effects on cellular physiology or technical artifacts.

What are the promising approaches for studying the interaction between qoxC and other oxidase subunits?

For investigating interactions between qoxC and other oxidase subunits, several promising approaches deserve consideration:

Crosslinking studies combined with mass spectrometry can identify specific points of contact between qoxC and other subunits. Chemical crosslinkers with varying spacer lengths can map the proximity relationships between subunits and help build structural models of the assembled complex.

Genetic suppressor screens can identify compensatory mutations in other subunits that restore function in qoxC mutants. Such genetic interactions provide powerful evidence for functional relationships between specific regions of interacting proteins.

Split-protein complementation assays, where fragments of reporter proteins are fused to potentially interacting domains, can monitor subunit interactions in vivo. This approach allows real-time visualization of complex assembly under various physiological conditions.

Computational approaches, including molecular dynamics simulations based on homology models, can predict interaction interfaces and guide experimental design. These predictions can be validated through targeted mutagenesis of predicted contact residues.

Co-evolution analysis of qox operon sequences across diverse bacterial species can identify co-evolving residue pairs that likely represent interaction points between subunits. This evolutionary perspective provides insight into the conservation of critical interaction interfaces.

How might advances in structural biology techniques enhance our understanding of qoxC function?

Advances in structural biology techniques offer transformative potential for understanding qoxC function:

Integrative structural biology approaches combining multiple techniques (X-ray crystallography, NMR, cryo-EM, and crosslinking mass spectrometry) can provide complementary structural information. For qoxC, which functions as part of a membrane-embedded complex, this multi-technique approach is particularly valuable.

Time-resolved structural methods can potentially capture the conformational changes in qoxC during the catalytic cycle of the oxidase. These dynamic structural insights would significantly enhance our understanding of how electron transfer and proton pumping are coupled.

In situ structural techniques, such as cryo-electron tomography, could eventually allow visualization of the oxidase complex in its native membrane environment, providing context for qoxC function within the cellular respiratory apparatus.

As these techniques continue to improve in resolution and accessibility, they will provide unprecedented insights into how qoxC contributes to oxidase assembly, stability, and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.