Recombinant Bacillus subtilis Riboflavin transporter FmnP (fmnP)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Function

Recombinant Bacillus subtilis Riboflavin transporter FmnP (fmnP) is encoded by the fmnP gene (synonyms: ribU, ypaA) and belongs to the Energy-Coupling Factor (ECF) transporter family . It facilitates riboflavin import via an ATP-independent mechanism, relying on transmembrane proton gradients . Key features include:

  • Structure: Five transmembrane domains (TMDs) and a conserved riboflavin-binding motif .

  • Function: Essential for riboflavin uptake in riboflavin-auxotrophic B. subtilis strains . Deletion of fmnP drastically increases cellular demand for exogenous riboflavin or its derivatives (FMN/FAD) .

Recombinant Expression Systems

FmnP has been heterologously expressed in multiple hosts for functional studies and industrial applications:

Host SystemYieldKey AdvantagesSource
Escherichia coliHighRapid production, cost-effective
Saccharomyces cerevisiaeHighEukaryotic post-translational modifications
Insect cellsModerateNative-like membrane protein folding
B. subtilis (His-tagged)LowEnables in vivo functional assays

Notable Constructs:

  • His₈-tagged FmnP: Used in Western blot analyses to quantify transporter synthesis under varying riboflavin concentrations .

  • Truncated Variants: Studies using MBP–C-RibR (C-terminal RNA-binding domain) confirmed FmnP’s regulation via FMN riboswitches .

Regulatory Mechanisms

FmnP expression is tightly controlled by FMN riboswitches and the flavokinase RibR:

  • FMN Riboswitch:

    • The ribU FMN riboswitch sequesters the ribosome-binding site at high FMN levels, repressing fmnP translation .

    • At low FMN, the riboswitch adopts a permissive structure, enabling FmnP synthesis .

  • RibR Protein:

    • Binds FMN riboswitch aptamers, overriding FMN-mediated repression during sulfur stress .

    • Enables fmnP expression even at high FMN levels (e.g., 0.5 µM riboflavin) .

Experimental Validation:

  • Western blots showed RibU (FmnP) synthesis in B. subtilis ΔribE strains only under RibR-inducing conditions (methionine/taurine) .

  • Electrophoretic mobility shift assays confirmed RibR binding to FMN riboswitch RNA .

Role in Metabolic Engineering

Recombinant FmnP has been leveraged to enhance riboflavin production in engineered strains:

  • Riboflavin Overproduction:

    • Deletion of FMN riboswitches in E. coli increased ribB transcript levels 3.05-fold, boosting riboflavin titer to 1,574 mg/L .

    • In B. subtilis, overexpression of the rib operon (ribDG, ribE, ribAB) with mutant zwf/gnd genes elevated yields to 977 mg/L .

  • Sulfur Metabolism Coupling:

    • RibR-mediated FmnP induction ensures flavin cofactor supply during sulfur compound assimilation (e.g., methionine) .

Industrial and Research Applications

  • Biosensor Development: FmnP’s riboswitch-dependent expression serves as a model for FMN-responsive genetic circuits .

  • Therapeutic Targets: Inhibiting FmnP could disrupt riboflavin uptake in pathogenic bacteria .

  • Bioreactor Optimization: High-yield FmnP expression in E. coli supports scalable riboflavin production .

Challenges and Future Directions

  • Expression Stability: Prolonged fermentation in E. coli risks plasmid loss; chromosomal integration of fmnP is being explored .

  • Structural Insights: Cryo-EM studies of recombinant FmnP could elucidate substrate-binding dynamics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will prioritize developing the specified tag if you have a particular tag type requirement. Please inform us of your preference.
Synonyms
fmnP; ribU; ypaA; BSU23050; Riboflavin transporter FmnP; FMN permease; Riboflavin ECF transporter S component FmnP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
fmnP
Target Protein Sequence
MKVKKLVVVSMLSSIAFVLMLLNFPFPGLPDYLKIDFSDVPAIIAILIYGPLAGIAVEAI KNVLQYIIQGSMAGVPVGQVANFIAGTLFILPTAFLFKKLNSAKGLAVSLLLGTAAMTIL MSILNYVLILPAYTWFLHSPALSDSALKTAVVAGILPFNMIKGIVITVVFSLIFIKLKPW IEQQRSAHIH
Uniprot No.

Target Background

Function
This protein mediates the uptake of riboflavin and roseoflavin, a toxic riboflavin analog. It may also transport FMN. It is likely a riboflavin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters, this ECF transporter provides the energy necessary for the transport of various substrates. The substrates themselves are bound by transmembrane, not extracytoplasmic soluble proteins.
Gene References Into Functions
  1. In B. subtilis, riboflavin uptake was enhanced when ypaA was overexpressed and abolished when ypaA was deleted. PMID: 17693491
Database Links
Protein Families
Prokaryotic riboflavin transporter (P-RFT) (TC 2.A.87) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does FmnP structurally and functionally compare to human riboflavin transporters?

While both bacterial FmnP and human riboflavin transporters (encoded by SLC52A2/RFVT2 and SLC52A3/RFVT3 genes) share the common function of transporting riboflavin, they differ significantly in several aspects. Human transporters belong to the solute carrier family and mutations in these genes are associated with Brown-Vialetto-Van Laere syndrome, a neurodegenerative disorder characterized by progressive bulbar palsy with sensorineural deafness . Bacterial FmnP typically belongs to a different transporter family with distinct structural arrangements optimized for prokaryotic membranes. These differences manifest in substrate specificity, transport kinetics, and regulatory mechanisms. For researchers, understanding these distinctions is essential when using B. subtilis as a model system for studying riboflavin transport or when developing biotechnological applications involving FmnP expression systems.

What are the optimal strategies for enhancing FmnP expression when integrated into riboflavin production pathways?

Optimizing FmnP expression within riboflavin production pathways requires a multifaceted approach focusing on genetic stability, expression regulation, and metabolic balance. The most effective strategy involves creating synthetic operons similar to those developed for other riboflavin pathway genes (guaB, guaA, gmk, ndk, ribA), which have demonstrated a 3.09-fold increase in riboflavin production . For FmnP specifically, researchers should consider:

  • Promoter selection that balances expression levels with metabolic burden

  • Codon optimization specific to B. subtilis to enhance translation efficiency

  • Strategic genomic integration to ensure stable inheritance and consistent expression

  • Co-expression with complementary pathway components, particularly those involved in the conversion of IMP to DARPP, which are critical rate-limiting steps in riboflavin biosynthesis

How can researchers optimize membrane extraction and purification protocols for FmnP while maintaining protein functionality?

Successful membrane extraction and purification of functional FmnP requires carefully optimized protocols that preserve the protein's native structure and transport activity. A systematic approach should include:

  • Membrane preparation:

    • Gentle cell lysis using enzymatic methods or controlled sonication

    • Differential centrifugation to isolate membrane fractions

    • Careful buffer composition including protease inhibitors and stabilizing agents

  • Solubilization optimization:

    • Screening of detergents (mild non-ionic detergents like DDM, LMNG, or digitonin)

    • Detergent concentration titration to minimize denaturation

    • Addition of lipids or cholesterol analogs to stabilize membrane proteins

    • Inclusion of riboflavin as a stabilizing ligand during extraction

  • Chromatographic purification:

    • Multi-step purification combining affinity, ion exchange, and size exclusion

    • Temperature control throughout purification (typically 4°C)

    • Detergent exchange to more stable alternatives for long-term storage

  • Functionality assessment:

    • Development of transport activity assays using proteoliposomes

    • Substrate binding measurements using fluorescence-based techniques

    • Structural integrity verification via circular dichroism

Each purification step should be validated for FmnP retention using both activity assays and protein quantification methods. The critical factor for success is maintaining the delicate balance between effective solubilization and functional preservation throughout the extraction and purification process.

What methodological approaches can reliably measure FmnP transport kinetics and substrate specificity?

Accurate measurement of FmnP transport kinetics and substrate specificity requires specialized methodological approaches that can quantitatively assess transporter function. The most reliable techniques include:

  • Reconstituted proteoliposome assays:

    • Incorporation of purified FmnP into artificial liposomes

    • Creation of controlled transmembrane gradients (pH, ion concentrations)

    • Measurement of riboflavin flux using:

      • Direct fluorescence detection (riboflavin autofluorescence)

      • Radiolabeled substrate transport with scintillation counting

      • HPLC-based quantification with UV detection

  • Real-time binding and transport studies:

    • Surface plasmon resonance for binding kinetics determination

    • Stopped-flow spectrofluorometry for rapid kinetic measurements

    • Isothermal titration calorimetry for thermodynamic parameters

  • Electrophysiological methods:

    • Patch-clamp electrophysiology if transport is electrogenic

    • Solid-supported membrane-based electrophysiology

    • Two-electrode voltage clamp in Xenopus oocytes expressing FmnP

For rigorous characterization, researchers should determine key parameters including:

  • Km and Vmax values for riboflavin and potential alternative substrates

  • Transport directionality (import/export capabilities)

  • Energy coupling mechanisms (ATP-dependence, ion gradients, etc.)

  • Inhibitor profiles and competitive substrate interactions

These measurements should be performed under varying conditions (pH, temperature, membrane composition) to establish a comprehensive kinetic profile of FmnP transport activity.

What experimental design would best evaluate the impact of horizontal gene transfer of fmnP variants on riboflavin production?

A comprehensive experimental design to evaluate the impact of horizontal gene transfer (HGT) of fmnP variants on riboflavin production should incorporate evolutionary, genetic, and biochemical approaches:

  • Variant acquisition and characterization:

    • Collection of fmnP homologs from diverse bacterial species

    • Sequence alignment and phylogenetic analysis to classify variants

    • Initial in silico prediction of functional differences

  • Transformation experimental design:

    • Utilization of naturally competent B. subtilis strains

    • Construction of recipient strains with:

      • Fluorescent reporters linked to riboflavin production

      • Disabled or altered native riboflavin transporters

    • Transformation with genomic DNA containing diverse fmnP variants

  • Selection and competition strategy:

    • Serial passage under riboflavin production conditions

    • Competition-based fitness measurements between strains harboring different variants

    • Quantification of variant frequency changes over time using sequencing

  • Phenotypic characterization:

    • Measurement of riboflavin production titers under standardized conditions

    • Determination of transport kinetics for each variant

    • Assessment of growth characteristics and metabolic burdens

  • Genomic analysis:

    • Whole-genome sequencing to identify acquired mutations

    • Analysis of genomic integration sites and potential regulatory impacts

    • Calculation of Average Nucleotide Identity (ANI) between donor species and B. subtilis to correlate with functional compatibility

This experimental framework would enable researchers to systematically evaluate how horizontal gene transfer of fmnP variants affects riboflavin production capacity and provide insights into evolutionary optimization of transport functions.

How can CRISPR-Cas9 genome editing be optimized for precise modification of fmnP and associated regulatory elements?

Optimizing CRISPR-Cas9 genome editing for precise modification of fmnP and its regulatory elements requires specialized strategies for membrane protein genes:

  • gRNA design considerations:

    • Selection of target sites that minimize off-target effects

    • Avoidance of highly structured regions in the fmnP gene

    • Design of gRNAs targeting regulatory regions with minimal impact on adjacent genes

    • Validation of gRNA efficiency through in vitro cleavage assays

  • Repair template engineering:

    • Incorporation of silent mutations to prevent re-cutting

    • Inclusion of appropriate homology arms (typically 500-1000 bp)

    • Strategic addition of epitope tags that don't disrupt transmembrane domains

    • Integration of tunable regulatory elements or riboswitches

  • Delivery optimization for B. subtilis:

    • Evaluation of different Cas9 delivery methods (plasmid-based vs. RNP)

    • Optimization of transformation protocols specifically for B. subtilis competent cells

    • Temporal control of Cas9 expression to minimize cytotoxicity

    • Co-selection strategies to enrich for edited cells

  • Validation approaches:

    • Development of functional screening assays based on riboflavin transport

    • Sanger sequencing verification of edited regions

    • RT-qPCR measurement of expression levels post-editing

    • Western blot confirmation of protein production

  • Multiplex editing strategies:

    • Simultaneous modification of fmnP and related pathway genes

    • Coordinated editing of transporters and biosynthetic enzymes

    • Creation of regulatory circuit modifications affecting multiple pathway components

For most effective outcomes, researchers should implement editing protocols that maintain the delicate balance between editing efficiency and retention of cell viability, particularly important when modifying essential membrane transport systems.

How does medium composition affect the expression and functionality of recombinant FmnP in different host systems?

Medium composition exerts significant influence on both expression levels and functionality of recombinant FmnP across different host systems through multiple mechanisms:

  • For E. coli expression systems:

    • Rich media (such as Terrific Broth) generally enhance yield but may accelerate expression leading to inclusion bodies

    • Defined media allow better control of induction parameters and often improve folding quality

    • Supplementation with riboflavin (5-10 μM) can stabilize the expressed transporter

    • Addition of rare tRNAs may overcome codon bias limitations

  • For yeast expression systems:

    • Carbon source selection affects promoter regulation (glucose vs. galactose for GAL promoters)

    • Nitrogen source composition influences protein quality control systems

    • Phosphate concentration impacts membrane composition and transporter insertion

  • For insect and mammalian cell systems:

    • Serum concentration affects membrane fluidity and composition

    • Media osmolarity influences membrane tension and protein folding

    • Lipid supplementation can enhance proper membrane protein folding

  • General considerations across all systems:

    • Divalent cation (Mg²⁺, Ca²⁺) concentrations affect membrane stability

    • Osmolarity impacts membrane protein folding and insertion efficiency

    • pH optimization is critical for maintaining protein stability during expression

Recent optimization studies for riboflavin production have employed Box-Behnken design approaches to systematically evaluate the effects of key medium components like yeast extract, corn steep powder, and ammonium sulfate . Similar methodological approaches could be adapted specifically for optimizing FmnP expression by measuring both protein yield and transport activity as response variables under different media compositions.

What strategies effectively optimize fermentation conditions for maximum FmnP activity in recombinant B. subtilis strains?

Optimizing fermentation conditions for maximum FmnP activity in recombinant B. subtilis requires a systematic approach addressing both cellular physiology and protein functionality:

  • Growth phase management:

    • Implementation of two-phase fermentation separating growth and production

    • Determination of optimal induction timing relative to growth phase

    • Monitoring of cell density with spectrophotometric measurements (OD600)

    • Controlled nutrient limitation to trigger production phase

  • Environmental parameter optimization:

    • Temperature modulation (lower temperatures often favor membrane protein folding)

    • pH control within narrow ranges to maintain transporter stability

    • Dissolved oxygen levels affecting membrane composition

    • Mixing parameters to maintain homogeneity without excessive shear stress

  • Substrate feeding strategies:

    • Fed-batch approaches to prevent catabolite repression

    • Pulse feeding of precursors at strategic timepoints

    • Riboflavin supplementation to stabilize expressed transporter

    • Carbon source selection and feeding rate optimization

  • Monitoring and control systems:

    • Real-time measurement of riboflavin levels using spectrophotometric methods

    • Transcriptional analysis of fmnP expression during fermentation

    • Proteomics approaches to quantify membrane-inserted vs. aggregated FmnP

    • Activity assays using membrane vesicles isolated during fermentation

  • Scale-up considerations:

    • Maintenance of oxygen transfer rates across scales

    • Adaptation of mixing parameters to preserve membrane integrity

    • Temperature gradient mitigation in larger vessels

    • Consistent nutrient distribution throughout the culture volume

When implementing these strategies, researchers should perform rigorous statistical analysis of fermentation parameters using response surface methodology or other design-of-experiment approaches to identify optimal conditions and potential parameter interactions, similar to the Box-Behnken design employed for medium optimization in riboflavin production studies .

How do salt concentration and osmotic stress affect FmnP expression, folding, and transport activity in experimental systems?

Salt concentration and osmotic stress significantly impact FmnP expression, folding, and transport activity through multiple molecular mechanisms:

Researchers investigating these effects should implement experimental designs that systematically vary salt concentration while monitoring multiple parameters, including expression levels (via Western blotting), membrane localization (via fractionation), and transport activity (via functional assays). These experiments should be complemented with structural analyses to correlate salt effects with specific changes in protein conformation and membrane interactions.

How might genetic mutations in fmnP be engineered to enhance riboflavin export capabilities in production strains?

Engineering genetic mutations in fmnP to enhance riboflavin export capabilities requires a rational design approach focusing on specific transporter properties:

  • Substrate binding pocket modifications:

    • Site-directed mutagenesis of residues lining the binding pocket to decrease affinity (increasing Koff rates)

    • Enlargement of the binding pocket to enhance transport rate

    • Modification of gating residues to favor outward-facing conformations

  • Energy coupling alterations:

    • Mutations affecting coupling to ion gradients or ATP hydrolysis

    • Engineering of unidirectional transport by disrupting inward transport capability

    • Modification of regulatory domains that control transport directionality

  • Expression and stability enhancements:

    • Codon optimization for enhanced expression in production strains

    • Mutations improving protein stability under industrial fermentation conditions

    • Modifications to reduce susceptibility to proteolytic degradation

  • Methodology for directed evolution:

    • Development of high-throughput screening assays based on riboflavin export

    • Creation of selective pressure systems that favor enhanced export

    • Combination of rational design with random mutagenesis of key domains

  • Integration with existing strain improvements:

    • Compatibility with strains already engineered for enhanced riboflavin synthesis pathways

    • Coordination with modifications affecting the conversion from IMP to DARPP

    • Balancing transporter expression with biosynthetic capacity

What potential exists for using engineered FmnP variants in creating bacterial biosensors for riboflavin detection?

Engineered FmnP variants offer significant potential for developing sophisticated bacterial biosensors for riboflavin detection with applications in research, environmental monitoring, and diagnostics:

  • Sensor design principles:

    • Coupling FmnP transport activity to reportable cellular responses

    • Engineering FmnP variants with altered sensitivity ranges (modified Km values)

    • Creating chimeric proteins linking transport activity to signaling domains

  • Signal transduction mechanisms:

    • Transcriptional reporters activated upon riboflavin transport

    • FRET-based sensors using conformational changes in FmnP

    • Riboswitch-based systems coupled to FmnP transport

    • Two-component signaling systems triggered by riboflavin internalization

  • Output modalities:

    • Fluorescence reporters with varying spectral properties for multiplexed detection

    • Bioluminescent readouts for applications requiring no excitation

    • Colorimetric changes for field-deployable detection systems

    • Growth-based selection systems for enrichment applications

  • Performance enhancement approaches:

    • Protein engineering to increase sensitivity or dynamic range

    • Signal amplification cascades to enhance detection limits

    • Mathematical modeling of sensor response characteristics

    • Adaptation mechanisms to prevent sensor saturation

  • Practical applications:

    • Environmental monitoring of riboflavin in water systems

    • Quality control in food and pharmaceutical production

    • Research tools for studying riboflavin transport in complex biological systems

    • Diagnostic applications related to riboflavin metabolism disorders

Development of such biosensors would require integrated approaches combining protein engineering, synthetic biology circuit design, and analytical validation. Sensitivity, specificity, dynamic range, and response time would need systematic optimization through iterative design-build-test cycles, potentially benefiting from the directed evolution approaches used in experimental evolution studies of B. subtilis .

How can structural biology techniques be optimized to resolve the three-dimensional architecture of FmnP for rational engineering?

Resolving the three-dimensional architecture of FmnP presents significant challenges that require optimization of multiple structural biology techniques:

  • X-ray crystallography optimization:

    • Screening of detergent/lipid combinations to enhance crystal formation

    • Implementation of lipidic cubic phase crystallization methods

    • Surface engineering to create crystal contacts without disrupting transport function

    • Co-crystallization with antibody fragments to stabilize specific conformations

    • Utilization of designed ankyrin repeat proteins (DARPins) as crystallization chaperones

  • Cryo-electron microscopy approaches:

    • Sample preparation optimization in nanodiscs or amphipols

    • Strategies to overcome preferred orientation issues common for membrane proteins

    • Implementation of focused refinement for flexible domains

    • Time-resolved studies capturing different conformational states

  • Integrated structural approaches:

    • Hydrogen-deuterium exchange mass spectrometry for dynamics information

    • Solid-state NMR for specific structural constraints

    • Small-angle X-ray scattering for solution-state conformational ensemble

    • Cross-linking mass spectrometry to establish distance constraints

  • Computational methods integration:

    • Molecular dynamics simulations in explicit membrane environments

    • Enhanced sampling techniques to explore conformational space

    • Homology modeling based on structurally characterized transporters

    • Machine learning approaches (AlphaFold2) with experimental validation

  • Functional validation of structural data:

    • Site-directed mutagenesis of predicted functional residues

    • Transport assays correlating structural features with activity

    • Accessibility studies using chemical modifications

    • FRET-based distance measurements in functioning transporters

The structural information obtained through these optimized approaches would provide the foundation for rational engineering efforts targeting specific properties like substrate specificity, transport rate, and directional bias. Capturing multiple conformational states would be particularly valuable for understanding the complete transport cycle and identifying potential intervention points for engineering enhanced function.

Table 1: Comparative Expression Systems for Recombinant FmnP Production

Expression SystemYieldTurnaround TimePost-translational ModificationsAdvantagesLimitations
E. coliHigh1-3 daysMinimalBest yields, rapid production, cost-effective Limited PTMs, potential inclusion body formation
YeastHigh3-5 daysModerateGood yields, some PTMs, cost-effective Hyperglycosylation may occur, different membrane composition
Insect cellsModerate7-14 daysExtensiveSuperior folding, most PTMs present Longer production time, higher cost, specialized expertise required
Mammalian cellsLow-Moderate14-28 daysMost completeNative-like PTMs, ideal for functional studies Lowest yields, highest cost, most time-consuming

Table 2: Impact of Synthetic Operon Components on Riboflavin Production in B. subtilis

Gene CombinationRelative Riboflavin ProductionKey FunctionsReference
Complete synthetic operon (guaB, guaA, gmk, ndk, ribA)309%Full pathway enhancement from IMP to DARPP
Without gmk198% (36% decrease from complete)Reduced GMP kinase activity affects precursor availability
Without guaB and guaA<198% (further reduced)Impaired conversion of IMP to GMP
Genomic integration with optimized medium3477 mg/LMaximum reported production

Table 3: Methodological Approaches for Assessing FmnP Function

Assay TypeMethodologyParameters MeasuredTechnical Considerations
Liposome reconstitutionFluorescence-based detectionTransport kinetics, substrate specificityRequires purified protein and synthetic liposomes
Binding studiesMicroscale thermophoresis, ITCBinding affinity (Kd), thermodynamic parametersRequires highly pure protein, sensitive instrumentation
Whole-cell assaysRiboflavin uptake in deficient strainsFunctional complementation, in vivo activitySimpler setup but less specific for mechanistic details
Competition assaysGrowth advantages in mixed populationsRelative fitness contributionRequires genomic integration, extended timeframes
Spectroscopic methodsFluorescence quenchingStructural changes upon substrate bindingLeverages riboflavin's intrinsic fluorescence

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.