Recombinant Bacillus subtilis Sec-independent protein translocase protein TatCy (tatC2)

Shipped with Ice Packs
In Stock

Description

Functional Role in the Tat Pathway

TatCy operates within the TatAyCy translocase, which is dedicated to secreting the iron-dependent peroxidase YwbN in B. subtilis . Key functional insights include:

  • Substrate Specificity: TatCy enables selective binding and translocation of YwbN, distinguishing it from the TatAdCd translocase responsible for PhoD secretion .

  • Domain Criticality:

    • The C-terminal domain of TatCy is indispensable for activity; truncations here abolish YwbN translocation .

    • Chimeric proteins combining TatCy and TatCd (from the TatAdCd system) fail to secrete substrates, underscoring domain-specific roles .

  • Cross-Compatibility: In E. coli, TatCy can form functional translocases with TatAc (a third TatA subunit in B. subtilis), though this interaction does not support known substrates in native B. subtilis .

Research Findings and Mutational Studies

Recent studies have elucidated TatCy's mechanistic contributions:

Table 1: Functional Impact of TatCy Mutations

ModificationEffect on FunctionSource
C-terminal deletion (residues 240–254)Complete loss of YwbN secretion
N-terminal conserved residue mutagenesis (e.g., D15A)Reduced substrate binding and translocation efficiency
Chimera with TatCd transmembrane domainInactive translocase; no PhoD or YwbN secretion

These findings highlight TatCy's structural precision in substrate recognition and translocase assembly.

Heterologous Expression and Applications

Recombinant TatCy is primarily used to dissect Tat system mechanisms and engineer protein secretion platforms:

  • Expression Systems: Produced in E. coli via plasmids (e.g., pBAD24), enabling biochemical and structural analyses .

  • Biotechnological Potential:

    • Secretion Engineering: TatCy could be leveraged to export complex proteins (e.g., multicopper oxidases) in industrial B. subtilis strains .

    • Mechanistic Studies: Reconstitution of TatAyCy in E. coli provides insights into gram-positive Tat machinery .

Challenges and Future Directions

While recombinant TatCy has advanced understanding of Tat translocases, gaps remain:

  • Unidentified Substrates: TatCy may participate in translocating uncharacterized substrates in B. subtilis, as suggested by its compatibility with TatAc in non-native hosts .

  • Structural Resolution: High-resolution structures of TatCy-containing complexes are needed to clarify substrate-binding interfaces.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
tatC2; tatCy; ydiJ; BSU05990; Sec-independent protein translocase protein TatCy
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
tatC2
Target Protein Sequence
MTRMKVNQMSLLEHIAELRKRLLIVALAFVVFFIAGFFLAKPIIVYLQETDEAKQLTLNA FNLTDPLYVFMQFAFIIGIVLTSPVILYQLWAFVSPGLYEKERKVTLSYIPVSILLFLAG LSFSYYILFPFVVDFMKRISQDLNVNQVIGINEYFHFLLQLTIPFGLLFQMPVILMFLTR LGIVTPMFLAKIRKYAYFTLLVIAALITPPELLSHMMVTVPLLILYEISILISKAAYRKA QKSSAADRDVSSGQ
Uniprot No.

Target Background

Function
This protein is a component of the twin-arginine translocation (Tat) system, which transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. It is essential for the secretion of YwbN.
Gene References Into Functions
  1. The two B. subtilis translocases, TatAdCd and TatAyCy, function independently as substrate-specific translocases for the twin-arginine preproteins PhoD and YwbN, respectively. PMID: 15554971
Database Links
Protein Families
TatC family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Sec-independent protein translocase TatCy in Bacillus subtilis?

TatCy (also designated tatC2) is an essential component of the TatAyCy translocation system in Bacillus subtilis. Unlike Gram-negative bacteria that require three components (TatABC) for functional Tat translocation, B. subtilis utilizes a more minimal system consisting of only TatA and TatC components . TatCy functions as part of the TatAyCy complex, which forms a discrete membrane-embedded structure responsible for recognizing and translocating folded proteins across the cytoplasmic membrane. The TatC component is generally considered the primary substrate recognition component of the Tat system, while TatA components are thought to form the protein-conducting channel .

TatCy specifically pairs with TatAy to form a functional translocase that exhibits distinct substrate preferences compared to the TatAdCd system, although they recognize similar signal peptide determinants . Structurally, TatCy is a membrane protein that plays a crucial role in controlling the formation and organization of Tat complexes in B. subtilis.

How does the Tat pathway in B. subtilis differ from the Sec pathway?

The Tat (Twin-arginine translocation) pathway differs fundamentally from the Sec pathway in several key aspects:

  • Substrate conformation: The Tat pathway transports fully folded proteins across the membrane, whereas the Sec pathway translocates proteins in an unfolded state.

  • Signal peptide characteristics: Tat substrates contain a distinctive twin-arginine motif (S/T-R-R-x-F-L-K) in their signal peptides, which is specifically recognized by TatC components .

  • Energy requirements: The Tat system relies primarily on the proton motive force for translocation, while the Sec pathway utilizes ATP hydrolysis.

  • Complex composition: In B. subtilis, the Tat pathway operates with minimal TatAC-type complexes, whereas the Sec machinery involves multiple components including SecYEG, SecA, and accessory proteins.

  • Substrate selection: The Tat pathway typically handles proteins that fold rapidly in the cytoplasm, contain cofactors that are inserted prior to translocation, or assemble into oligomeric complexes before transport.

What methods can be used to visualize TatCy localization and dynamics?

Fluorescence microscopy using TatC-GFP fusion proteins has proven effective for studying the subcellular localization of Tat components in B. subtilis. Researchers have successfully employed C-terminal green fluorescent protein (GFP) fusions to visualize the distribution of Tat components within the cell .

The methodology involves:

  • Construction of TatCy-GFP fusion proteins using plasmid vectors like pSG1154 for xylose-inducible expression

  • Transformation of the constructs into various B. subtilis strains (wild-type or Tat-deficient)

  • Induction of expression under controlled conditions

  • Microscopic analysis of fluorescence patterns

When expressed, TatC components typically display a peripheral membrane localization with discrete foci often concentrated at cell division sites or poles . This pattern differs from the uniform distribution seen with some other membrane proteins, suggesting specialized organization of the Tat machinery.

For dynamic studies, techniques such as Fluorescence Recovery After Photobleaching (FRAP) or single-molecule tracking could be employed, though these approaches are not explicitly described in the provided search results.

How can researchers generate functional recombinant TatCy for in vitro studies?

Producing functional recombinant TatCy for biochemical studies requires careful consideration of its membrane protein nature. A methodological approach would include:

  • Gene amplification and cloning:

    • PCR amplification of the tatCy gene from B. subtilis chromosomal DNA

    • Incorporation of appropriate restriction sites (similar to the approach used for tatAy: "The tatAy gene was amplified by using primers 5′-TAA GGT ACC ATG CCG ATC GGT CCT GG-3′ (forward, KpnI site) and 5′-AAG CTT ATC GAT CTG ATC TTC TTT CTT TTT TTC C-3′ (reverse, ClaI site)")

    • Ligation into suitable expression vectors with affinity tags

  • Expression system selection:

    • E. coli-based systems with specialized strains for membrane protein expression

    • Alternatively, homologous expression in B. subtilis for proper folding and insertion

  • Membrane protein solubilization and purification:

    • Careful selection of detergents for membrane extraction

    • Affinity chromatography using engineered tags

    • Size-exclusion chromatography to isolate intact TatAyCy complexes

  • Functional validation:

    • In vitro reconstitution assays with known substrates

    • Assessment of protein-protein interactions with TatAy

    • Binding studies with Tat signal peptides

When studying TatCy, it's crucial to maintain the native interaction with TatAy, as the functional unit is the TatAyCy complex rather than individual components .

What is currently known about the structural organization of TatAyCy complexes?

Biochemical analyses have revealed that TatAyCy forms discrete complexes that differ significantly from their counterparts in Gram-negative bacteria. Key structural characteristics include:

  • Formation of a discrete TatAyCy complex together with a separate, homogeneous TatAy complex of approximately 200 kDa

  • Significant structural differences between TatAy complexes and the corresponding E. coli TatA complexes, suggesting evolutionary adaptations specific to Gram-positive bacteria

  • TatAy, like TatAd, can also form massive cytosolic complexes, indicating a dual localization pattern

  • The localization of TatA components in focal points depends on the presence of the corresponding TatC component, suggesting TatC controls TatA complex formation

A particularly interesting finding is that TatAd-GFP foci can be observed not only in the presence of its cognate partner TatCd but also in the presence of TatCy, suggesting potential cross-talk between the two Tat systems . This indicates that while the two systems have distinct substrate preferences, there may be structural features that allow for cross-interaction between components.

Unlike the variable-sized TatA complexes observed in E. coli, the TatAy complex in B. subtilis appears more homogeneous in size, pointing to fundamental differences in the translocation mechanism between Gram-negative and Gram-positive bacteria .

How do TatAy and TatCy interact to form functional complexes?

The formation of functional TatAyCy complexes involves specific protein-protein interactions that are essential for Tat-dependent translocation. The current understanding of these interactions includes:

  • TatCy appears to serve as an organizing center for TatAy, as the localization of TatAy-GFP in discrete foci depends on the presence of TatCy

  • The interaction between TatAy and TatCy is likely mediated by specific domains, although the exact interaction sites have not been fully characterized in the provided search results

  • Functional studies suggest that expression of plasmid-borne tatAy or tatCy alone can strongly interfere with the secretion of TatAyCy-dependent substrates like YwbN, indicating that the proper stoichiometry between these components is critical for function

  • The observation that TatAd can interact with TatCy (in addition to its cognate partner TatCd) suggests some degree of structural conservation in the interaction interfaces between different Tat components

These findings highlight the importance of balanced expression of TatA and TatC components for proper complex formation and function. Overexpression of individual components may lead to non-functional complexes or interfere with normal Tat-dependent translocation processes.

What are the substrate recognition determinants of the TatAyCy system?

The TatAyCy system recognizes and translocates specific substrate proteins through interaction with distinctive signal peptides. The key recognition determinants include:

  • The presence of a twin-arginine motif (S/T-R-R-x-F-L-K) in the signal peptide, which is critically important for targeting to the Tat pathway

  • Despite having different substrate specificities in B. subtilis, both TatAyCy and TatAdCd systems recognize similar signal peptide determinants, as demonstrated by their ability to translocate green fluorescent protein fused to various E. coli Tat signal peptides (DmsA, AmiA, and MdoD)

  • Mutagenesis studies of the DmsA signal peptide have confirmed that both Tat pathways in B. subtilis recognize similar targeting determinants within Tat signals

  • Notably, while both systems can recognize similar signal peptides, TatAdCd can translocate the E. coli Tat substrate trimethylamine N-oxide reductase (TorA), whereas TatAyCy cannot, suggesting additional factors beyond just the signal peptide influence substrate specificity

These findings indicate that the TatAyCy system is not predisposed to recognize only specific Tat signal peptides, despite its apparently narrow substrate specificity in B. subtilis. The basis for this selectivity likely involves additional factors such as the mature domain of the substrate protein or specific interaction sites within the translocase complex.

What specific proteins are known to be translocated by the TatAyCy system in B. subtilis?

The TatAyCy system in B. subtilis has been shown to translocate several specific proteins:

  • YwbN - The most well-characterized native substrate of the TatAyCy system in B. subtilis. YwbN secretion is particularly important under high salinity conditions (LB with 6% NaCl)

  • Heterologous substrates - The TatAyCy system can translocate green fluorescent protein when fused to certain E. coli Tat signal peptides, specifically:

    • GFP fused to DmsA signal peptide

    • GFP fused to AmiA signal peptide

    • GFP fused to MdoD signal peptide

  • The TatAyCy system cannot translocate trimethylamine N-oxide reductase (TorA) from E. coli, which is instead transported by the TatAdCd system

This substrate selectivity demonstrates that while both Tat systems in B. subtilis can recognize similar signal peptide determinants, they maintain distinct substrate preferences that likely evolved to serve different physiological functions.

How does the absence of TatCy affect B. subtilis growth and physiology?

Genetic studies have revealed several significant physiological consequences of TatCy deficiency in B. subtilis:

  • Growth defects - B. subtilis strains lacking tatAyCy show significantly reduced growth rates during the exponential phase when grown in LB medium with low salinity

  • Stationary phase entry - tatAyCy and total-tat mutants exhibit lower growth yields compared to tatAyCy-proficient strains and are unable to enter directly into stationary phase

  • Cell lysis phenotype - Mutants lacking tatAyCy display a severe lysis phenotype, reflected by a significant drop in culture optical density

  • Growth recovery - Surviving tatAyCy mutant cells can resume growth approximately 1.5 hours after the onset of cell lysis, but at a lower rate than during initial exponential growth

  • Protein secretion defects - The absence of TatAyCy prevents the secretion of its specific substrate YwbN, particularly under high salinity conditions (LB with 6% NaCl)

These observations highlight the importance of the TatAyCy system for normal cellular physiology in B. subtilis, particularly for growth and survival under specific environmental conditions. The severe growth phenotypes suggest that TatAyCy-dependent protein translocation plays critical roles beyond the secretion of individual proteins, potentially affecting cell wall integrity or other essential cellular processes.

Under what conditions is TatCy expression regulated in B. subtilis?

The expression of Tat components in B. subtilis, including TatCy, appears to be regulated in response to specific environmental and physiological conditions:

  • Salinity effects - The TatAyCy system is particularly important for the secretion of YwbN under high salinity conditions (LB with 6% NaCl)

  • Growth phase dependency - The requirement for TatAyCy becomes evident during specific growth phases, particularly during the transition to stationary phase

  • Genetic regulation - While the specific transcriptional regulators of tatAyCy are not explicitly detailed in the provided search results, the physiological effects of tatAyCy deletion suggest that its expression is coordinated with cellular processes related to growth phase transitions and adaptation to environmental stress

  • Co-regulation with substrate genes - It's possible that tatAyCy expression is coordinated with the expression of its substrate proteins, though specific regulatory mechanisms are not detailed in the provided search results

These observations suggest that TatCy expression and function are integrated into the broader physiological response of B. subtilis to environmental challenges, particularly those related to osmotic stress and nutrient limitation during the transition to stationary phase.

What genetic approaches can be used to study TatCy function?

Several genetic approaches have proven valuable for investigating TatCy function in B. subtilis:

  • Gene deletion/disruption:

    • Construction of tatCy knockout mutants using antibiotic resistance markers

    • Example: "B. subtilis 168 ΔtatCy was constructed as follows: the Sp resistance marker in plasmid pJCy2 was removed by digestion with PstI and replaced by an Em resistance marker derived from plasmid pLR300 digested with BglII and ClaI. The cleaved pJCy2 and Em resistance marker-encoding fragments were blunt ended with T4 DNA polymerase, and ligation was performed."

    • Validation of successful disruption by checking the inability of the resulting strain to secrete TatCy-dependent substrates

  • Complementation studies:

    • Reintroduction of tatCy on plasmids to restore function in deletion mutants

    • Use of inducible promoters (e.g., xylose-inducible) to control expression levels

  • Fusion proteins for localization:

    • Creation of TatCy-GFP fusions for visualization of protein localization

    • Design considerations for maintaining functionality (typically C-terminal fusions)

  • Site-directed mutagenesis:

    • Introduction of specific mutations to identify critical residues for function

    • Analysis of effects on substrate recognition and translocation efficiency

  • Substrate reporter systems:

    • Fusion of Tat signal peptides to reporter proteins like GFP

    • Quantification of translocation efficiency under various conditions or with mutated TatCy variants

These approaches have collectively contributed to our understanding of TatCy function and its role in the broader context of protein translocation in B. subtilis.

How can researchers construct a recombinant TatCy expression system?

Construction of a recombinant TatCy expression system requires careful consideration of several factors to ensure proper expression, localization, and functionality. Based on the methodologies described in the search results, a comprehensive approach would include:

  • Gene amplification and vector construction:

    • PCR amplification of the tatCy gene from B. subtilis chromosomal DNA

    • Incorporation of appropriate restriction sites for cloning

    • Ligation into expression vectors with suitable promoters (constitutive or inducible)

    • Optional addition of affinity tags for purification or epitope tags for detection

  • Expression host selection:

    • B. subtilis-based expression for homologous production

    • E. coli-based systems for heterologous expression

    • Consideration of specialized strains optimized for membrane protein expression

  • Promoter selection:

    • Inducible promoters (e.g., xylose-inducible) for controlled expression

    • Native promoter for physiological expression levels

    • Strong constitutive promoters for overexpression

  • Functional validation:

    • Complementation of tatCy deletion mutants

    • Assessment of substrate translocation (e.g., YwbN secretion)

    • Protein-protein interaction studies with TatAy

  • Optimization considerations:

    • Proper stoichiometry with TatAy is crucial for function

    • Overexpression of TatCy alone may interfere with native Tat system function

    • Co-expression with TatAy may be necessary for proper complex formation

A particularly important consideration is that separate expression of tatCy alone can strongly interfere with the secretion of Tat-dependent substrates like YwbN , suggesting that balanced expression of both TatAy and TatCy is critical for proper function.

What methodological challenges exist in studying TatCy function in vivo?

Investigating TatCy function in vivo presents several significant methodological challenges:

  • Membrane protein expression and stability:

    • As a membrane protein, TatCy can be difficult to express at appropriate levels

    • Overexpression may lead to mislocalization or aggregation

    • Maintaining native conformation during extraction and analysis is challenging

  • Functional complex formation:

    • TatCy functions as part of a multiprotein complex with TatAy

    • Proper stoichiometry between components is critical

    • Expression of tatCy alone can interfere with native function

  • Substrate specificity determination:

    • Identifying the complete range of natural substrates is difficult

    • Cross-talk between TatAdCd and TatAyCy systems complicates analysis

    • The basis for substrate selectivity involves factors beyond just signal peptide recognition

  • Growth condition dependencies:

    • TatCy function is influenced by growth conditions such as salinity

    • Phenotypes of tatCy mutants vary with environmental conditions

    • Timing of expression and activity during growth phases affects experimental design

  • Functional redundancy:

    • The presence of multiple Tat systems in B. subtilis creates potential redundancy

    • TatAd can interact with TatCy, suggesting cross-functionality

    • Disentangling the specific contributions of each component requires careful genetic approaches

These challenges necessitate integrated approaches combining genetics, biochemistry, and cell biology to fully elucidate TatCy function and regulation in vivo.

Is there evidence for cross-functionality between TatAyCy and TatAdCd systems?

The search results provide several lines of evidence suggesting cross-functionality between the TatAyCy and TatAdCd systems in B. subtilis:

  • Component interactions:

    • TatAd-GFP foci can be observed not only in the presence of its cognate partner TatCd but also in the presence of TatCy

    • This observation suggests that TatAd can interact with TatCy, indicating potential cross-talk between the two systems

  • Signal peptide recognition:

    • Both TatAdCd and TatAyCy systems can recognize and process similar signal peptide determinants

    • Both systems can translocate GFP fused to various E. coli Tat signal peptides (DmsA, AmiA, and MdoD)

    • Mutagenesis of the DmsA signal peptide confirms that both pathways recognize similar targeting determinants

  • Functional cooperation:

    • Under high salinity conditions (LB with 6% NaCl), TatAd, TatAy, and TatCy all appear to be involved in the Tat-dependent secretion of YwbN

    • This suggests a situation reminiscent of the three-component TatABC translocase in Gram-negative bacteria, indicating potential cooperative function

  • Limitations to cross-functionality:

    • Despite the potential for component interaction, there are clear functional differences: TatAdCd can translocate the E. coli Tat substrate trimethylamine N-oxide reductase (TorA), whereas TatAyCy cannot

    • Expression of plasmid-borne tatAdCd genes in a tatAyCy mutant does not restore secretion of YwbN under certain conditions

These observations suggest a complex relationship between the two Tat systems in B. subtilis, with evidence for both cross-functionality at the component level and maintenance of distinct substrate preferences at the system level. This partial redundancy may provide flexibility to meet varying translocation demands under different environmental conditions.

Comparison of TatCy with other bacterial Tat system components

The following table summarizes key differences between TatCy and related components in different bacterial systems:

FeatureB. subtilis TatCyB. subtilis TatCdE. coli TatC
System compositionPart of TatAyCyPart of TatAdCdPart of TatABC
Native substratesYwbNPhoDMultiple (~30)
Complex sizeDiscrete complex with TatAy (~200 kDa)Discrete complex with TatAd~440 kDa complex with TatB
Growth conditionsImportant at high salinityExpressed under phosphate limitationConstitutive
Cross-functionalityCan interact with TatAdLimited evidence for interaction with TatAyNo B. subtilis homolog
Mutant phenotypeGrowth defects, cell lysisMinimal growth effectsEssential for anaerobic growth
Heterologous substrate translationDmsA, AmiA, MdoD signals (not TorA)DmsA, AmiA, MdoD, TorA signalsMultiple diverse substrates

This comparative analysis highlights the specialized yet partially overlapping functions of the different Tat systems in B. subtilis compared to the more versatile system in E. coli .

What experimental conditions are optimal for studying TatCy function?

Based on the search results, the following experimental conditions appear optimal for studying TatCy function:

Experimental FocusOptimal ConditionsReadout/Analysis MethodNotes
YwbN secretionLB medium with 6% NaClWestern blot or activity assayHigh salinity enhances TatAyCy-dependent secretion
TatCy localizationExpression from xylose-inducible promoterFluorescence microscopy of TatC-GFP fusionShows peripheral and focal distribution
Growth phenotypesStandard LB mediumGrowth curves monitoring OD600tatAyCy mutants show lysis during transition to stationary phase
Component interactionsCo-expression of TatAy and TatCyCo-immunoprecipitation or fluorescence co-localizationProper stoichiometry is critical
Substrate specificityHeterologous expression of test substrates with Tat signalsDetection of secreted reporter proteinsGFP fusions with various signal peptides are effective
Functional complementationExpression from controlled promoters in deletion backgroundsRestoration of growth and secretion phenotypesBalanced expression levels are important

These conditions provide a framework for designing experiments to investigate different aspects of TatCy function, with consideration for the specific physiological contexts in which the TatAyCy system plays important roles.

What are the unresolved questions regarding TatCy structure and function?

Despite significant progress in understanding TatCy, several important questions remain unresolved:

  • Structural details:

    • What is the three-dimensional structure of TatCy and the TatAyCy complex?

    • How does this structure differ from that of TatC in Gram-negative bacteria?

    • What structural features enable interaction with both TatAy and TatAd?

  • Mechanism of action:

    • How exactly does TatCy recognize and bind to signal peptides?

    • What conformational changes occur during the translocation process?

    • How is proton motive force coupled to protein movement?

  • Regulation:

    • What environmental and cellular factors regulate tatCy expression?

    • How is the stoichiometry between TatAy and TatCy maintained?

    • What mechanisms control the formation and disassembly of TatAyCy complexes?

  • Physiological significance:

    • What is the complete inventory of natural TatAyCy substrates in B. subtilis?

    • Why does TatCy deficiency cause growth defects and cell lysis?

    • How do the two Tat systems in B. subtilis cooperate under different conditions?

  • Evolutionary considerations:

    • Why have Gram-positive bacteria evolved minimal TatAC systems while Gram-negative bacteria use TatABC systems?

    • What selective pressures maintain two distinct Tat systems in B. subtilis?

Addressing these questions will require integrated approaches combining structural biology, advanced microscopy, genetics, biochemistry, and systems biology.

How might TatCy research contribute to broader understanding of bacterial protein secretion?

Research on the B. subtilis TatCy protein has significant implications for broader understanding of bacterial protein secretion:

  • Evolutionary insights:

    • Comparisons between the minimal TatAC systems in Gram-positive bacteria and the TatABC systems in Gram-negative bacteria can reveal evolutionary adaptations in protein translocation mechanisms

    • Understanding why B. subtilis maintains two parallel Tat systems with distinct substrate preferences may illuminate evolutionary strategies for specialized protein secretion

  • Fundamental mechanisms:

    • B. subtilis TatCy provides a simplified model for understanding the core requirements of Tat-dependent translocation

    • Cross-talk between TatAd and TatCy suggests fundamental principles governing component compatibility

  • Biotechnological applications:

    • Insights from TatCy research could inform the development of improved expression systems for folded proteins in Gram-positive hosts

    • Understanding the determinants of substrate specificity could enable engineering of Tat systems with expanded or altered substrate ranges

  • Comparative physiology:

    • The differential importance of TatCy under various growth conditions highlights how protein secretion systems adapt to environmental challenges

    • The severe phenotypes of tatCy mutants reveal connections between protein secretion and fundamental cellular processes like cell wall integrity

  • Structural biology advances:

    • The distinct properties of TatAyCy complexes compared to E. coli Tat complexes provide an opportunity to understand structural diversity in seemingly related translocation systems

    • Potential insights into how similar components can assemble into functionally distinct complexes

By exploring these aspects of TatCy biology, researchers can gain broader insights into the diversity, evolution, and fundamental mechanisms of bacterial protein secretion systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.