Recombinant Bacillus subtilis Sensor histidine kinase desK (desK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Sensor Kinase DesK (desK)

The recombinant Bacillus subtilis sensor histidine kinase DesK (desK) is a transmembrane protein critical for regulating membrane fluidity in response to temperature changes. It functions as part of a two-component signaling system (DesK/DesR) that activates the des gene, encoding a Δ5 acyl lipid desaturase. This enzyme introduces unsaturated fatty acids into membrane phospholipids, restoring fluidity under cold stress . The recombinant form of DesK is produced in Escherichia coli with an N-terminal His-tag for purification and structural studies .

Mechanism of Action

DesK operates as a thermosensor that detects cold-induced membrane rigidification:

  1. Cold Activation:

    • Decreased membrane fluidity triggers structural rearrangements in the TM domain, transmitting signals via a two-helix coiled-coil (2-HCC) to the cytoplasmic kinase domain .

    • The cytoplasmic domain undergoes conformational changes, favoring autokinase activity over phosphatase activity .

  2. Signal Transduction:

    • DesK phosphorylates itself (autokinase) and transfers the phosphate to DesR (phosphotransferase) .

    • Phosphorylated DesR activates des transcription, increasing unsaturated fatty acids, which restore membrane fluidity and inhibit further DesK kinase activity .

Regulation of DesR

  • Phosphorylation/Dephosphorylation Cycle:

    • DesKC transfers phosphate to DesR (kinase activity) and removes it (phosphatase activity) .

    • Unsaturated fatty acids act as feedback inhibitors, promoting phosphatase activity and terminating des transcription .

Recombinant Production and Applications

The recombinant His-tagged DesK (1–370 aa) is produced in E. coli for structural and functional studies .

ParameterSpecificationSource
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS, 6% trehalose, pH 8.0

Product Specs

Form
Lyophilized powder
Note: While we will preferentially ship the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timeframes, please contact your local distributors.
Note: All of our proteins are shipped with standard blue ice packs unless otherwise specified. If you require dry ice shipping, please communicate this requirement in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please specify it in your request. We will prioritize the development of the specified tag.
Synonyms
desK; yocF; BSU19190; Sensor histidine kinase DesK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-370
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
desK
Target Protein Sequence
MIKNHFTFQKLNGITPYIWTIFFILPFYFIWKSSSTFVIIVGIILTLLFFSVYRFAFVSK GWTIYLWGFLLIGISTASITLFSYIYFAFFIAYFIGNIKERVPFHILYYVHLISAAVAAN FSLVLKKEFFLTQIPFVVITLISAILLPFSIKSRKERERLEEKLEDANERIAELVKLEER QRIARDLHDTLGQKLSLIGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEVRKIVSS MKGIRLKDELINIKQILEAADIMFIYEEEKWPENISLLNENILSMCLKEAVTNVVKHSQA KTCRVDIQQLWKEVVITVSDDGTFKGEENSFSKGHGLLGMRERLEFANGSLHIDTENGTK LTMAIPNNSK
Uniprot No.

Target Background

Function
DesK is a member of the two-component regulatory system DesR/DesK in *Bacillus subtilis*, responsible for cold induction of the *des* gene, which encodes the Delta5 acyl-lipid desaturase. DesK functions as a sensor of membrane fluidity and likely activates DesR through phosphorylation.
Gene References Into Functions
  1. Lipid membrane thickness fluctuates with temperature, and DesK can detect these variations with remarkable precision. PMID: 27528507
  2. In vivo and biochemical experiments, structural analyses, and simulations have demonstrated that stabilization/destabilization of a 2-helix coiled coil plays a direct role in regulating DesK's functional state. PMID: 26172072
  3. A lipid-mediated conformational switch modulates the thermosensing activity of DesK. PMID: 24522108
  4. Data show that the membrane-bound histidine kinase DesK phosphorylates the response regulator DesR to activate *des* transcription. PMID: 19595746
  5. Structural comparisons of different DesK variants suggest that incoming signals can take the form of helix rotations and asymmetric helical bends, similar to those reported for other sensing systems. PMID: 19805278

Show More

Hide All

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is DesK and what is its primary function in Bacillus subtilis?

DesK is a membrane-bound histidine kinase that functions as a thermosensor in Bacillus subtilis. It detects decreases in ambient temperature below approximately 30°C and initiates a signaling cascade that leads to membrane lipid remodeling . DesK, together with its cognate response regulator DesR, constitutes a canonical two-component system that regulates the expression of the des gene, which encodes the Δ5 acyl lipid desaturase . This enzyme introduces double bonds into fatty acids, increasing membrane fluidity at lower temperatures, which is crucial for bacterial adaptation to cold environments .

The DesK/DesR system is the founding example of a membrane-bound thermosensor and has become a model system for studying transmembrane signaling mechanisms. The increased fraction of unsaturated fatty acids in the membrane restores fluidity and shuts off the kinase activity of DesK, terminating transcription of the des gene .

How does the DesK/DesR two-component system regulate membrane fluidity?

The DesK/DesR two-component system regulates membrane fluidity through a temperature-dependent signaling cascade:

  • Signal sensing: When the temperature drops below approximately 30°C, DesK detects changes in membrane physical properties (primarily thickness)

  • Autokinase activity: Cold temperature activates DesK's autokinase function, leading to ATP-dependent autophosphorylation at a conserved histidine residue (H188)

  • Phosphotransfer: Phosphorylated DesK transfers the phosphoryl group to an aspartate residue in the response regulator DesR

  • Transcriptional activation: Phosphorylated DesR binds to the promoter region of the des gene, activating its transcription

  • Desaturase production: The des gene encodes Δ5-Des, an acyl lipid desaturase that introduces double bonds into fatty acid chains of membrane phospholipids

  • Membrane modification: Increased levels of unsaturated fatty acids enhance membrane fluidity, compensating for the rigidifying effects of cold temperature

  • Feedback regulation: As membrane fluidity is restored, DesK switches from kinase to phosphatase activity, dephosphorylating DesR and shutting off des transcription

This regulatory loop allows B. subtilis to maintain optimal membrane fluidity despite temperature fluctuations, which is critical for cell survival in changing environments.

What is the structural organization of DesK?

DesK is a class I histidine kinase with a modular architecture consisting of:

  • N-terminal sensor domain: Composed of 4-5 transmembrane (TM) segments (approximately 150 residues) that span the bacterial membrane and detect changes in temperature through alterations in membrane properties .

  • C-terminal cytoplasmic domain (DesKC): Approximately 220 residues that belong to the HisKA_3 subfamily (PFAM 00730) of histidine kinases , containing:

    • Dimerization and Histidine phosphotransfer (DHp) domain: Forms a four-helix bundle (4-HB) in the dimer, containing the conserved histidine residue (H188) that is the site of autophosphorylation

    • Catalytic/ATP-binding domain (ABD): Binds ATP and catalyzes the phosphorylation of the histidine residue in the DHp domain

    • Connecting two-helix coiled-coil: Links the transmembrane sensor domain to the cytoplasmic catalytic core, playing a crucial role in signal transduction

Crystal structures of DesKC in different functional states have revealed remarkable plasticity of the central four-helix bundle domain, which influences the catalytic activities of the protein by modifying the mobility of the ATP-binding domains for autokinase activity or by modulating binding of the cognate response regulator for phosphotransferase and phosphatase activities .

What experimental systems are commonly used to study DesK function?

Several experimental systems are employed to study DesK function, each with specific advantages:

  • Full-length DesK in native membranes: Studies in wild-type B. subtilis cells using temperature shifts and monitoring des gene expression provide insights into the physiological role of DesK .

  • Truncated variants: DesKC (cytoplasmic portion) and other truncated forms are used for structural studies and in vitro activity assays, as they are easier to express and purify than the full-length membrane protein .

  • Reconstituted systems:

    • Full-length DesK reconstituted into proteoliposomes of defined lipid composition allows controlled studies of how membrane properties affect DesK function

    • In vitro reconstitution of the DesK/DesR two-component system with purified components permits detailed biochemical characterization of autokinase, phosphotransferase, and phosphatase activities

  • Mutant variants:

    • Point mutations (e.g., H188V, H188E) that lock DesK in specific functional states (phosphatase or kinase) provide insights into structure-function relationships

    • Transmembrane proline mutants help understand signal sensing mechanisms

  • Reporter systems:

    • Transcriptional fusions of the des promoter with reporter genes like lacZ or GFP allow monitoring of DesK/DesR activity in vivo

    • DesK-GFP fusions permit visualization of localization and dynamics in living cells

  • Deletion mutants: Strains with deletions in des, desK, or desR genes help assess the physiological importance of this system under various stress conditions .

What are the key methodologies for preparing B. subtilis samples to study DesK?

Proper preparation of B. subtilis samples is crucial for studying DesK effectively:

  • Cell culture conditions:

    • B. subtilis strains are typically cultured in LB medium to mid-log growth phase (OD600 reaching 0.8–1)

    • For temperature shift experiments, cultures grown at 37°C are transferred to lower temperatures (typically 25°C) for specific time periods

  • Sample collection:

    • Aliquots equivalent to a standardized OD600 (e.g., 2.4) are collected by centrifugation (13,000 g for 5 min)

    • For time-course experiments, samples are collected at regular intervals after temperature shift to monitor response dynamics

  • Cell lysis methods:

    • For full-length membrane-bound DesK: Cells are resuspended in a lysis buffer containing lysozyme and disrupted by sonication or French press

    • For proteomic analysis: Cells are resuspended in lysis buffer with lysozyme, mixed with sample loading buffer, and centrifuged to collect supernatant

  • Protein analysis:

    • SDS-PAGE: Standard technique for analyzing DesK and DesR protein levels

    • Western blotting: For specific detection of DesK or epitope-tagged versions

    • Membrane fractionation: To isolate and study membrane-bound DesK

  • Activity assays:

    • For reporter gene studies: β-galactosidase activity assays for lacZ fusions or fluorescence measurements for GFP fusions

    • For transcriptional analysis: RNA extraction followed by RT-PCR quantitation

  • Microscopy preparation:

    • For localization studies: Cells expressing DesK-GFP are washed and mounted on agarose pads for fluorescence microscopy

    • For membrane visualization: Membrane-specific dyes like FM4-64 or laurdan can be used in conjunction

These methodologies provide a comprehensive toolkit for investigating DesK function from the molecular to the cellular level.

What structural changes occur in DesK during thermosensing and signal transduction?

DesK undergoes complex conformational rearrangements across different domains during thermosensing and signal transduction:

  • Transmembrane sensing domain:

    • Cold temperature increases membrane thickness, causing hydrophobic mismatch with the TM helices

    • TM1 and TM5 contain key structural elements for signal sensing and transduction

    • Transmembrane proline residues act as molecular hinges, facilitating conformational changes

    • These changes are transmitted to the connecting two-helix coiled-coil (2-HCC)

  • Connecting coiled-coil:

    • In the phosphatase state (warm temperature), the 2-HCC forms a stable left-handed parallel arrangement

    • Cold activation disrupts this stability, causing rotation of the helices by approximately 90°

    • This unwinding of the 2-HCC is crucial for signal propagation to the catalytic domain

  • Dimerization and Histidine phosphotransfer (DHp) domain:

    • The central four-helix bundle domain exhibits remarkable plasticity

    • In the phosphatase state (DesKC H188V structure), the DHp domain forms extensive interactions with the ATP-binding domain (ABD)

    • Cold activation causes interhelical rearrangements that modify these interactions

    • Specifically, helices α1 and α2 undergo rotational movements and asymmetric bending

  • ATP-binding domain (ABD):

    • In the phosphatase state, the ABD is sequestered by the DHp domain

    • Cold activation releases this interaction, allowing the ABD to access the conserved histidine residue

    • This increases mobility of the ABDs, enabling autophosphorylation

  • Phosphorylated state:

    • Histidine phosphorylation induces an asymmetric conformation with pronounced bending of helix α1

    • This conformation is competent for interaction with DesR for phosphotransfer

The structural changes induced by temperature sensing involve helix rotations and asymmetric helical bends similar to those reported for other sensing systems, suggesting a similar switching mechanism could be operational in many sensor histidine kinases .

How do lipid composition and membrane properties affect DesK function?

Lipid composition and membrane properties have profound effects on DesK function, as DesK directly senses changes in the physical state of the membrane:

  • Acyl chain length:

    • Longer acyl chains increase membrane thickness, which activates DesK kinase activity

    • Shorter acyl chains decrease membrane thickness, promoting phosphatase activity

    • Reconstitution studies with proteoliposomes of varying acyl chain lengths have demonstrated that membrane thickness is a primary determinant of DesK activity

  • Lipid saturation:

    • Saturated fatty acids create more ordered, rigid membranes that activate DesK kinase function

    • Unsaturated fatty acids increase membrane fluidity, switching DesK to phosphatase function

    • This creates a feedback loop where DesK activation leads to increased unsaturated fatty acids, which then turn off DesK kinase activity

  • Head group structure:

    • Studies both in vitro and in vivo have shown that lipid head group structure has relatively little effect on DesK thermosensing compared to acyl chain properties

    • This suggests that DesK primarily senses the hydrophobic core of the membrane rather than the interfacial region

  • Phase separation:

    • Recent research indicates that lipid phase separation impairs membrane thickness sensing by DesK

    • When membranes undergo phase separation due to severe cold shock or antibiotic stress, DesK partitions into fluid membrane domains

    • This partitioning prevents effective thickness sensing, explaining why des expression is only activated by mild temperature shifts but not harsh cold shocks

  • Experimental evidence:

    • The Pdes promoter is only activated by a 2-hour temperature shift from 37°C to 25°C, but not under severe cold shock conditions

    • DesK-GFP localization studies show partitioning into fluid membrane domains upon phase separation

    • Neither the Pdes promoter nor deletion mutants respond significantly to antibiotic treatment, despite antibiotics causing membrane rigidification

This complex interplay between membrane physical properties and DesK activity highlights the sophisticated mechanisms by which bacteria sense and respond to environmental changes.

What are the key experimental approaches for studying DesK catalytic activities in vitro?

Studying DesK catalytic activities in vitro requires specialized techniques to assess its autokinase, phosphotransferase, and phosphatase functions:

  • Protein preparation:

    • Full-length DesK: Requires detergent solubilization and purification, or reconstitution into proteoliposomes

    • DesKC (cytoplasmic domain): Expression in E. coli as a soluble protein, typically with a His-tag for purification

    • DesK variants: H188V (phosphatase-competent), truncation mutants like DesKC Δ174 (autokinase-active)

  • Autokinase activity assays:

    • Radiometric assay: Incubation of purified DesK/DesKC with [γ-32P]ATP, followed by SDS-PAGE and autoradiography to detect autophosphorylation

    • Time-course experiments: Monitoring phosphorylation levels over time to determine kinetic parameters

    • Western blot analysis: Using antibodies specific to phosphohistidine (though challenging due to phosphohistidine instability)

  • Phosphotransferase activity assays:

    • Two-step reactions: First autophosphorylating DesK with [γ-32P]ATP, then adding purified DesR and monitoring phosphotransfer

    • Gel-shift assays: Phosphorylated DesR often shows altered migration in native PAGE

  • Phosphatase activity assays:

    • Dephosphorylation of DesR~P: Preparing phosphorylated DesR (either chemically or enzymatically), then monitoring dephosphorylation when incubated with DesK variants

    • Time-course analysis: Determining the rate of phosphate removal

  • Structural studies:

    • X-ray crystallography: Has been successfully used to determine structures of DesKC in different functional states

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides information about protein dynamics and conformational changes

    • Electron spin resonance (ESR) spectroscopy: Used to study dynamic changes in protein structure

  • Reconstitution systems:

    • Proteoliposomes: DesK reconstituted into lipid vesicles of defined composition to study how membrane properties affect activity

    • Controlling lipid parameters: Systematically varying acyl chain length, saturation, and head group structure to understand their effects on DesK function

These approaches have been instrumental in elucidating the molecular mechanisms of DesK function and its remarkable conformational plasticity.

What are the challenges in expressing and purifying recombinant DesK for structural studies?

Expressing and purifying recombinant DesK for structural studies presents several challenges:

  • Membrane protein expression barriers:

    • Full-length DesK has multiple transmembrane segments, making it difficult to express in conventional systems

    • Overexpression often leads to protein misfolding, aggregation, or toxicity to host cells

    • Proper insertion into the membrane is critical for correct folding and function

  • Host selection considerations:

    • E. coli is commonly used but may not provide the appropriate membrane environment

    • B. subtilis expression systems may offer more native-like conditions but typically yield lower protein amounts

    • Cell-free expression systems have been explored as alternatives

  • Solubilization and stability issues:

    • Extracting DesK from membranes requires detergents that can destabilize the protein

    • Finding the optimal detergent or lipid-detergent mixture is often empirical and time-consuming

    • Maintaining protein stability during purification is challenging

  • Alternative approaches:

    • Truncated constructs: Using just the cytoplasmic portion (DesKC) simplifies expression and purification

    • Fusion proteins: Adding solubility tags can enhance expression and folding

    • Nanodiscs or amphipols: These systems can provide a more native-like membrane environment than detergent micelles

    • Reconstitution into proteoliposomes: Offers a controlled membrane environment for functional studies

  • Specific methodological considerations:

    • For B. subtilis expression:

      • Strains lacking multiple proteases (up to ten different ones) have been developed to reduce protein degradation

      • The "mini-Bacillus" strain PG10, which lacks ~36% of the genome, can enhance production of difficult proteins

      • The use of strong, inducible promoters like Pgrac212 can improve expression levels

    • For E. coli expression:

      • Specialized strains for membrane protein expression are preferred

      • Lowering induction temperature (16-18°C) can reduce aggregation

      • Codon optimization for the expression host may improve translation efficiency

These challenges have driven researchers to develop creative solutions, including the use of truncated constructs for structural studies and specialized reconstitution systems for functional characterization.

How do transmembrane prolines contribute to DesK signal sensing and decoding?

Transmembrane prolines play critical roles in DesK signal sensing and decoding through their unique structural properties:

  • Structural features of proline in transmembrane helices:

    • Proline creates a kink or bend in α-helices due to its rigid cyclic structure

    • It lacks a backbone NH group for hydrogen bonding, disrupting regular α-helical structure

    • These properties make proline residues act as molecular hinges or switches within transmembrane domains

  • Role in DesK mechanosensing:

    • Transmembrane prolines in DesK modulate the conformational switch of the 2-helix coiled-coil (2-HCC) structural motif

    • This motif controls input-output coupling in DesK and many other histidine kinases

    • Prolines facilitate the transmission of conformational changes from the membrane sensor domain to the cytoplasmic catalytic domain

  • Experimental evidence:

    • Mutational studies of transmembrane prolines in DesK demonstrate their importance for thermosensing

    • Proline to alanine mutations alter the temperature threshold for DesK activation

    • Computational simulations of transmembrane helices containing prolines show differential responses to membrane thickness changes

  • Mechanism of action:

    • In fluid membranes (warm temperature), prolines help maintain a conformation favoring phosphatase activity

    • When membrane thickness increases (cold temperature), the proline-induced kinks allow specific helix rotations and translations

    • These movements are amplified and transmitted through the connecting helices to the catalytic domain

    • The result is destabilization of the 2-HCC and release of the ABD from the DHp domain, enabling kinase activity

  • Biological significance:

    • Prolines are highly conserved in transmembrane domains of many sensor histidine kinases

    • Their conservation suggests a common mechanism for signal transduction across various sensing systems

    • This highlights the importance of proline-mediated conformational flexibility in membrane protein function

The study of transmembrane prolines in DesK provides insights into fundamental principles of membrane protein signaling, demonstrating how specific amino acid residues can play pivotal roles in transmembrane signal transduction mechanisms.

How does DesK interact with its cognate response regulator DesR?

The interaction between DesK and its cognate response regulator DesR is a critical aspect of the signal transduction process:

  • Structural basis of interaction:

    • The DHp domain of DesK provides the primary interaction surface for DesR binding

    • Different conformational states of DesK's DHp domain show varying affinities for DesR

    • In the phosphatase-competent state (DesKC H188V), the DHp surface is competent to interact with DesR

  • Phosphotransfer mechanism:

    • Phosphorylated DesK (at H188) forms a complex with DesR

    • The phosphoryl group is transferred from His188 of DesK to an aspartate residue in DesR's receiver domain

    • This phosphotransfer reaction is rapid and specific

    • The phosphorylated DesR then dissociates from DesK

  • Phosphatase activity:

    • DesK also catalyzes the dephosphorylation of phosphorylated DesR (DesR~P)

    • This phosphatase activity requires a specific conformation of the DHp domain

    • The H188V variant of DesK retains phosphatase activity comparable to wild-type, making it a useful model for this functional state

  • Regulation of interaction:

    • Temperature-induced conformational changes in DesK modulate its interaction with DesR

    • In the kinase-competent state, the DHp surface is modified, affecting DesR binding

    • Complex formation studies show that unphosphorylated DesK in the kinase-active state (e.g., DesKC Δ174) does not form a stable complex with DesR

  • Experimental evidence:

    • Size-exclusion chromatography experiments have demonstrated different binding behaviors with various DesK conformational states

    • The DesKC H188E mutant can adopt multiple conformations similar to both kinase-active and phosphotransferase states

    • This suggests a low energy barrier between these functional states

Understanding the molecular details of DesK-DesR interaction provides insights into the mechanisms of signal transduction in two-component systems and how conformational changes in the histidine kinase can regulate downstream responses.

What factors affect membrane phase separation and how does this impact DesK function?

Membrane phase separation significantly impacts DesK function, as revealed by recent research:

  • Factors promoting membrane phase separation:

    • Temperature: Severe cold shock induces phase separation more readily than mild temperature shifts

    • Lipid composition: Higher proportions of saturated lipids increase the likelihood of phase separation

    • Antimicrobial compounds: Many antibiotics induce lipid phase separation as part of their mechanism

    • Membrane proteins: Protein crowding can influence domain formation and phase behavior

  • Characteristics of phase-separated membranes:

    • Coexistence of ordered and disordered domains:

      • Gel-like ordered domains (Lo) enriched in saturated lipids

      • Fluid disordered domains (Ld) containing more unsaturated lipids

    • Thickness differences: Ordered domains are typically thicker than disordered domains

    • Altered protein distribution: Membrane proteins often partition preferentially into specific domains

  • Impact on DesK function:

    • Partitioning of DesK into fluid domains:

      • Recent research shows that DesK-GFP localizes to fluid membrane domains upon phase separation

      • This partitioning removes DesK from the thickened rigid domains

      • Results in impaired membrane thickness sensing

    • Limited activation under harsh conditions:

      • Des expression is only activated by mild temperature shifts (37°C to 25°C)

      • Severe cold shock or antibiotic stress fails to activate the system despite causing membrane rigidification

      • This paradox is explained by DesK's partitioning behavior

  • Experimental evidence:

    • Fluorescence microscopy: Shows DesK-GFP clustering in specific membrane regions

    • Transcriptional assays: Demonstrate that des expression is not activated by severe stress conditions

    • Deletion mutant studies: B. subtilis strains lacking des, desK, or desR show no increased sensitivity to antibiotics or temperature stress

  • Physiological implications:

    • Limited role in severe stress adaptation:

      • Des system may be more important for adaptation to mild fluctuations than severe stress

      • Other membrane adaptation mechanisms likely predominate under harsh conditions

      • The minimal inhibitory concentrations of various antibiotics are virtually identical for wild-type and des/desK/desR deletion mutants (see Table 1)

Table 1: Relative MIC values of antibiotics against B. subtilis wild-type and des system deletion mutants

AntibioticWild-typeΔdesΔdesKΔdesR
Daptomycin1.01.01.01.0
Vancomycin1.01.01.01.0
Bacitracin1.01.00.5-1.01.0
Nisin1.01.01.01.0
Polymyxin B1.01.0-2.01.01.0

Note: Values represent fold-change relative to wild-type MIC. A value of 1.0 indicates identical MIC to wild-type .

These findings represent a significant advance in our understanding of how membrane phase behavior affects sensor function, revealing that the physical organization of the membrane plays a crucial role in determining how sensors like DesK detect and respond to environmental signals.

How can the DesK system be engineered for biotechnological applications?

The DesK system offers several opportunities for biotechnological applications through engineering approaches:

  • Biosensor development:

    • Temperature-responsive gene expression systems:

      • Using the des promoter and DesK/DesR to control expression of reporter genes or therapeutic proteins

      • Applications in temperature-controlled production of recombinant proteins

      • Potential for developing whole-cell biosensors for temperature monitoring

    • Membrane stress reporters:

      • Engineering the DesK sensor domain to respond to specific membrane perturbations

      • Potential applications in screening antibiotic compounds that affect membrane properties

  • Recombinant protein production in B. subtilis:

    • Temperature-inducible expression systems:

      • The des promoter can be used for controlled expression of recombinant proteins

      • B. subtilis has GRAS (Generally Recognized as Safe) status and QPS (Qualified Presumption of Safety) status, making it attractive for production of food enzymes and biotherapeutics

      • The platform could be particularly useful for proteins sensitive to proteolysis, as expression can be induced at lower temperatures where protease activity is reduced

  • Expression optimization strategies:

    • Host strain engineering:

      • Use of protease-deficient B. subtilis strains (up to ten proteases can be deleted)

      • Implementation in the mini-Bacillus strain PG10 that lacks ~36% of the genome

      • This minimized chassis has been shown to be favorable for "difficult-to-produce proteins"

    • Promoter and signal sequence optimization:

      • Strong promoters like Pgrac212 can be used in conjunction with the des regulatory system

      • Appropriate signal sequences can be selected for efficient secretion of recombinant proteins

  • Challenges and considerations:

    • System transfer to non-native hosts:

      • Ensuring proper membrane insertion and function in different organisms

      • Addressing potential cross-talk with endogenous two-component systems

    • Performance optimization:

      • The des system senses very subtle membrane fluidity changes that escape detection by established fluidity reporters like laurdan

      • The limited response under severe conditions must be considered when designing applications

  • Regulatory considerations:

    • For recombinant DNA applications, researchers must follow NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules

    • Appropriate biosafety measures must be implemented based on the nature of the genetic modifications and intended applications

The DesK system's remarkable ability to sense physical properties of the membrane, coupled with its well-characterized molecular mechanism, makes it an attractive platform for developing novel biotechnological tools and applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.